style

Pure Electric Street Sweeper Truck

The car adopts the cleaning mode, equipped with lithium iron phosphate battery, can make up for the large cleaning car is not convenient to enter the cleaning area, suitable for non-motorized lanes,

Electric Road sweeper family series

Rear loading garbage truck

Mini rear loader garbage truck BY-L35 is mainly used for collecting garbage cans. widely used in urban sanitation,municipal,community,factory.also as "Samll garbage tipper truck"

Electric road washer and sweeping vehicle

Street washing and sweeping vehicle BY-CS60 sweeping mode turns dry sweeping into washing sweeping. widely used inmunicipal,sanitation,urban,property etc.also as “compact electric road

style

Electric leaf vacuum truck

Leaf vacuum truck BY-T50 has multi-functional urban road leaf cleaning functions,Widely used in municipal,sanitation,urban,property etc.also as "Electric leaf collector truck"

Street Washer Truck

Street washer truck BY-C15 Widely used in municipal,sanitation,urban,property etc.also as "small road pressure washer truck" and “street washing machine”

Self-loading & Dumping Garbage Truck

JBY5030ZZZBEV01 pure electric self-handling garbage truck is a special vehicle for sanitation developed by our company according to the needs of the market and customers, which is specially used for the operation of urban residential parks, shopping malls

Street Washing Truck

Street Washing Truck BY-C12 Widely used in municipal,sanitation,urban,property etc.also as "small road washer truck" and “street washing machine”

Pure Electric Garbage Tricycle

Pure Electric Side Mounted Hydraulic Lifting Garbage Tricycle,Electric Small Garbage Storage Transport Side Buckets Lifting Self Unloading Truck Trike,Widely used in communities, parks, schools, hospitals, hotels, restaurants, canteens, and sanitation mun

Electric Mini Street Sweeper

Electric mini street sweeper vehicle BY-S50 sweeping mode turns dry sweeping into washing sweeping. Widely used in Municipal,sanitation,urban,property etc.also as road sweeper

High-end electric sanitation cleaning vehicle

Garbage bin collection truck

Mini garbage bin collection truck widely used in the removal and transfer of garbage cans in urban sanitation,municipal,community,factory.also as "electric trash can removal truck"

Small leaf collection tricycle

Small leaf collection tricycle BY-T6 which can easily solve the problem of collecting fallen leaves in urban streets. also as “Urban suction leaf vacuum vehicle”

Enterprise style

Ride on Sweeper

BY-S15 Industrial Road Sweeper Machine Mini Street Sweeper adopts an automatic cleaning system of vacuuming and sweeping. This sweeper is mainly used for indoor and outdoor cleaning in colleges and universities, property communities, factory workshops, sq

Electric Ride on Sweeper

Pure Electric Street Sweeper Road Sweeper Machine BY-S19 is an automatic cleaning machine that combines vacuuming, sweeping and water spraying, and is used in outdoor environments. This sweeper is mainly used for indoor and outdoor cleaning of urban main

Four-category garbage truck

Four-category garbage truck BY-L8-M is widely used in class and transport of garbage bins in urban sanitation,municipal,community,factory.also as “Small electric garbage sorting truck”

Trailer-mounted tow-behind leaf collectors

Trailer-mounted tow-behind debris collectors BY-T3 also as “leaf vacuums”,the leaf suction machine can easily solve the problem of urban leaf collection.

Walk Behind Leaf Vacuum

Leaf Collector Vacuum BY-T2 can easily solve the problem of urban leaf collection.lawn sweeper.also as "walk behind leaf vacuum"

road washing sweeper,street small sweeper

Small Road Pressure Washer Tricycle

Street washer BY-C5 has multi-functional road cleaning functions,widely used in municipal,sanitation,urban,property etc.also as "road pressure washer tricycle"

Enterprise style

Pure Electric Ride On Road Sweeper

BY-S20 ride-on road sweeper is an automatic cleaning machine that combines vacuuming, sweeping and water spraying, and is used in outdoor environments. This sweeper is mainly used for indoor and outdoor cleaning of urban main/auxiliary roads, park roads,

OCCUPATIONAL HEALTH AND SAFETYMANAGEMENT SYSTEM CERTIFICATE

QUALITY MANAGEMENT SYSTEM CERTIFICATION

ENVIRONMENTAL MANAGEMENT SYSTEM CERTIFICATE

Two-category garbage truck

Two-category garbage truck BY-L20 is widely used in class and transport of garbage bins in urban sanitation,municipal,community,factory.also as “Small electric garbage sorting truck”

Black head garbage truck

Small Electric Water Tanker Truck

Small water tanker truck BY-X20 mainly used for sanitation road sprinkler and dust reduction,green watering.also as "Electric Sanitation road sprinkler"

Electric high pressure street washing tricycle

Electric high pressure street washing tricycle BY-C5 has multi-functional road cleaning functions and widely used in municipal,sanitation,urban,property etc.

Shandong Province Specialized Special New Certificate

High-tech Enterprise Certificate

Jinan Specialized Special New Certificate

China's top ten brands of environmental protection industry certificate

high pressure cleaning vehicle

Electric deep clean road sweeper

Electric Deep clean street sweeper BY-C30 have road sweeper,high pressure street cleaning truck and restoring the true color of the road.also as “Electric road cleaning machine vehicle”

Electric road leaf collector Baiyi-T50

Safety production certificate

Abide by contract and keep promise certificate

credit rating certificate

Utility model patent certificate

Full Electric Street Washing Tricycle

Electric street washing tricycle BY-C7-L is powered by new energy batteries and has multi-functional road cleaning functions. Widely used in municipal,sanitation,urban,property etc.

Environmental Management Certification System Certificate

Occupational Health Management Certification

诚信管理体系认证证书

企业信用等级证书

售后服务认证证书

质量管理体系认证证书

外观设计专利证书

创新设备荣誉证书

Enterprise style

New Energy Road Maintenance Vehicle: Modern Urban Cleaning Solution

As urbanization accelerates, the cleanliness and maintenance of urban environments have become key issues in modern city management. To address this challenge, a new multi-functional road cleaning vehicle powered by new energy has been introduced.

Pure Electric Street Sweeper BY-CS60: Empowering Municipal Sanitation Constructi

The BY-CS60 pure electric street sweeper​ adopts a pure electric drive system, achieving zero emissions and zero pollution. The launch of this vehicle not only responds to the current stringent environmental protection policies but also provides strong su

New Energy Garbage Collection Vehicle: An Efficient Tool for Urban Sanitation

Firstly, the design of new energy garbage collection vehicles prioritizes ease of operation and efficiency. These vehicles use a side-loading mechanism to efficiently collect 240-liter and 120-liter garbage bins. All functions can be operated with a singl

Ride-on Leaf Collection Vehicle: The Efficient and Convenient Expert in Ground L

The ride-on leaf collection vehicle​ is equipped with a high-performance gasoline engine that runs on 92-octane fuel. The powerful engine ensures efficient operation in various environments. The equipment features a one-button start design, making it easy

New Energy Road Cleaning Vehicle: Efficient and Eco-Friendly

As urbanization progresses, maintaining a clean city environment becomes increasingly important. Traditional cleaning tools are gradually falling short in terms of efficiency and environmental friendliness to meet modern urban demands. To address this iss

New Energy Road Cleaning Vehicle: Leading the New Trend in Maintenance

In modern urban management, maintaining clean and tidy roads is not only a requirement for city appearance but also an important aspect of improving residents' quality of life. To this end, the new energy road cleaning vehicle, a specialized road mainten

New Energy Garbage Collection Truck: A Green Pioneer in Urban Sanitation

With the continuous advancement of urbanization, urban sanitation issues are becoming increasingly prominent. To address the environmental pollution caused by waste disposal, new energy garbage collection trucks have emerged. This article will provide a d

Changan New Energy Sweeper: The Efficient and Eco-Friendly Urban Cleaning Tool

The Changan new energy sweeper​ is equipped with a robust heavy-duty chassis that maintains stable performance even when fully loaded. Whether it's large plazas, busy main roads, or narrow alleys, this sweeper can handle them all with ease, demonstrating

New Energy Road Maintenance Vehicle: Urban Cleaning Specialist

In the context of rapid urbanization, road maintenance and city cleaning have become increasingly important. The introduction of the new energy road maintenance vehicle provides a new solution for maintaining the urban environment. This advanced maintenan

New Side-Loading Garbage Truck: Ideal for Properties and Scenic Roads

Garbage collection is a crucial aspect of modern urban environmental management. With rapid urbanization and the growing awareness of environmental protection, traditional garbage collection equipment can no longer meet the increasing demand. Thus, a new

Pure Electric Street Sweeper BY-CS60 Boosts Scenic Area Sanitation Construction

Pure Electric Street Sweeper BY-CS60 Boosts Scenic Area Sanitation Construction With rapid urbanization and continuous improvement in living standards, maintaining urban environmental sanitation has become a crucial issue. Particularly in places like

New Energy Garbage Bin Collection Vehicle: A New Choice for Urban Environmental

With the acceleration of urbanization, environmental sanitation has become increasingly important. The new energy garbage bin collection vehicle​, with its efficiency and eco-friendliness, has emerged as a crucial tool in urban environmental sanitation co

New Energy Pure Electric Sweeper: Boosting Urban Environmental Construction

As urbanization accelerates, the importance of urban environmental construction and maintenance becomes increasingly prominent. To meet the high-efficiency demands of urban road cleaning, the new energy pure electric sweeper has become a significant asset

New Energy Garbage Truck Boosts Urban Sanitation and Environment

New Energy Garbage Truck Boosts Urban Sanitation and Environment As urbanization accelerates, efficient garbage management has become crucial. To enhance sanitation work and promote environmental protection, Hanzhong City has introduced an advanced new e

New Energy Side-Loading Garbage Truck: Ideal for Urban Environmental Protection

As global environmental issues become increasingly severe, urban waste management has emerged as a significant challenge for cities worldwide. To effectively address this problem, new sanitation equipment is continually being developed. Among these innova

Compact Electric Street Sweeper: The New Tool for Urban Cleanliness

In modern urban management, maintaining environmental hygiene is crucial. A compact electric street sweeper, with its unique advantages, has emerged as a new tool for urban cleanliness. This sweeper, which can be registered and licensed, boasts a small an

Eco-Friendly New Energy Garbage Trucks for Efficient Urban Cleaning

New Energy Garbage Collection Vehicles: An Eco-Friendly and Efficient Choice for Urban Cleaning With the growing global awareness of environmental issues and the national push for new energy vehicle policies, new energy garbage collection vehicles​ are

New Energy Street Sweeper Truck: Efficient and Eco-Friendly Urban Solution

With urban development and rising environmental standards, city cleaning faces increasing challenges. To address these issues, a new energy street sweeper has been introduced to the market. This innovative street sweeper, which can be licensed, features a

Small Electric Sweeper: The Green Pioneer of Urban Cleanliness

This small electric sweeper is designed with the practical needs of urban street cleaning in mind. It is operated by a single driver and is very simple to use, allowing anyone to easily master it after a short training period. The one-button operation des

New Force in Environmental Protection: Multi-Functional Street Washer Tricycle

In city streets and squares, cleanliness is crucial for ensuring the quality of life for residents. To meet increasingly complex cleaning demands, a new cleaning device, the "Multi-Functional Street Washer Tricycle," has emerged. With its unique

New Energy Leaf Collection Vehicle

The BY-T4500 multifunctional leaf collection vehicle effectively addresses the challenges of leaf collection and transportation during the peak leaf-fall season, such as high volume, large size, and difficulty in gathering and transporting leaves.

New Energy Leaf Collection Vehicle: A Green Solution for Urban Cleaning

In this context, the emergence of the new energy leaf collection vehicle provides a fresh solution for urban cleaning and becomes a powerful green tool for urban environmental management.

Pure Electric Eight-Bin Garbage Truck: Urban Cleaning Pioneer

As urbanization accelerates, managing household waste has become an increasingly serious issue. To effectively address this challenge, the pure electric eight-bin garbage transfer truck has emerged as an innovative and eco-friendly solution. This model no

New Rear-Loading Electric Garbage Truck: Professional Garbage Transport Solution

Garbage collection is an indispensable part of modern urban management and maintenance. As urbanization accelerates and environmental awareness increases, the demand for garbage collection trucks is also rising. To better meet this demand, a brand-new

New Energy Four-Wheel Side-Loading Garbage Truck Innovative Waste Transfer

Handling household waste is a critical task. To effectively meet this challenge, the new energy side-loading garbage truck, an advanced sanitation vehicle, has gradually entered our view. This garbage truck, powered by pure electric drive, features a stai

Shipment of Electric Leaf Collection Vehicles and Road Washer to Kazakhstan

The electric leaf collection vehicle is an essential piece of pure electric equipment for road cleaning during the autumn season. This vehicle has been specially developed for the efficient collection of fallen leaves on the roads. Equipped with

Side-Loading Garbage Collection Truck

The BY-L30 electric three-wheeled motorcycle (three-wheeled self-dumping garbage collection truck) is a self-loading and unloading garbage transport vehicle developed by the company. It complies with the Ministry of Industry and Information Technology's d

New Energy Washing and Sweeping Vehicle

The fully electric washing and sweeping vehicle adopts a washing and sweeping operation mode, integrating a dedicated chassis with a combined sweeping, washing, and suction system. It features a hydraulic self-dumping system and a "3D" integrate

New Energy High-Pressure Cleaning Vehicle

The fully electric road surface vehicle, also known as the "mini high-pressure water sweeper", possesses multifunctional cleaning capabilities. It is primarily used for fast cleaning and maintenance of city sidewalks, auxiliary lanes, and curbst

New Energy Self-loading and Unloading Garbage Truck

The fully electric self-loading and unloading garbage truck utilizes a new energy vehicle chassis and is a miniature side-loading garbage truck transporter. It is certified and can be registered, breaking the embarrassing situation where low-speed four-wh

Fully Electric Enclosed Barrel Garbage Truck

The fully electric enclosed barrel garbage truck utilizes a new energy vehicle chassis and serves as a miniature garbage bin transporter. It is certified and can be registered, breaking the embarrassing situation where low-speed four-wheel electric garbag

Pure Electric Garbage Sorting and Transport Vehicle

The pure electric garbage sorting and transport vehicle utilizes a new energy vehicle chassis, serving as a miniature garbage collection and transport truck. It comes with certification and is eligible for registration, addressing the embarrassing situat

Eco-Friendly Side-Loading Garbage Trucks for Urban Cleanliness

​In today's rapidly urbanizing world, managing household waste has become a crucial task. To effectively address this challenge, the new energy side-loading garbage truck, an innovative sanitation vehicle, has gradually entered our field of vision. This g

Baiyi Ships Electric Garbage Trucks to Thai Customer

The order for electric garbage trucks placed by the Thai customer is currently being shipped. Baiyi, committed to customer trust and product quality, is actively preparing the stock. We strictly adhere to the production processes and technical specificati

Pure Electric Sweeping and Washing Vehicles Delivered to Boost Urban Sanitation

Withtheaccelerationofurbanizationandtheimprovementofresidents'qualityoflife,maintainingurbanenvironmentalhygienehasbecomeparticularlyimportant.Recently,abrand-newpureelect

Electric Sweeper Truck Delivery: Boosting Urban Sanitation Efforts

Electric sweeper trucks offer several notable advantages. Firstly, their compact size and agile movement allow them to navigate through every corner of the city, including narrow streets and sidewalks. This design makes them more efficient in cleaning ope

Electric Rear-Loading Garbage Trucks: Improving City Sanitation

This rear-loading garbage truck adopts a rear-loading garbage form, which is simple and convenient to operate, greatly facilitating the work of sanitation workers. The vehicle uses pure electric drive, with the characteristics of low noise and zero pollut

Electric 3.5-Cubic-Meter Garbage Trucks: A Sustainable Solution for Urban Waste

The electric four-wheeled 3.5-cubic-meter bucket garbage truck is an environmentally friendly and energy-efficient waste collection vehicle that utilizes electricity as its power source. Compared to traditional fuel-powered garbage trucks, it has signific

Small Electric Sweepers: Leading the New Era of Cleaning

​Small electric sweepers, powered by batteries, are environmentally friendly, energy-saving, and produce no secondary pollution. They are suitable for a variety of road cleaning tasks and have vast market potential in the new energy electric vehicle marke

Electric road washing tricycle handover site

This versatile street washers tricycle​ features a three-wheel chassis with strong load-bearing capacity, equipped with an integrated 700L plastic water tank, ideal for daily cleaning in narrow streets and alleys. It can easily switch to working mode with

Small Tricycle Sprinkler Trucks: Versatile Allies for Urban Sanitation

Among the various tools employed to achieve this goal, small tricycle sprinkler trucks​ have emerged as invaluable assets due to their unique features and multifunctional capabilities.

Electric Street Washing Tricycle, Long-lasting Operation, Diverse Functions

In urban sanitation work, road cleaning and maintenance are crucial tasks. The emergence of the Electric Street Washing Tricycle BY-C7 injects new vitality and convenience into this task. This new model demonstrates extraordinary practicality and applicab

Dual-Classification Waste Collection Vehicle: Urban Waste Management

With the acceleration of urbanization, the treatment of household waste has become a crucial issue in urban management. In order to efficiently and environmentally process household waste, innovative waste collection vehicles have emerged. This vehicle mo

Revolutionizing Urban Sanitation: Electric Three-Wheel Street Washer

Experience a new era of urban environmental management with our innovative Electric Three-Wheel Street Washer . As urbanization accelerates, the focus on city cleanliness intensifies, prompting the need for more effective solutions. This electric-powered

New Energy Mini Street Sweeper: The Green Smart Tool for Municipal Sanitation

In this context, the emergence of the new energy mini street sweeper has become an indispensable guardian of road cleanliness for municipal sanitation. This vehicle not only complies with national policies on new energy vehicles but also provides reliable

Rear-loading Garbage Trucks: Guardians of Urban Environmental Sanitation

With the acceleration of urbanization, garbage collection and transportation has become a key issue in urban management. Rear-loading garbage trucks, with their high efficiency, convenience, and environmental protection features, have become the guardians

Advanced Urban Sanitation Solutions: Four-Wheel Street Washer Truck

"Discover an innovative solution for urban sanitation with our Four-Wheel Multifunctional Street Washer Truck. Designed for efficiency and eco-friendliness, this electric-powered vehicle tackles road management challenges effortlessly, from alley

Urban Environmental Stewardship: Rear-Mounted Garbage Collection Trucks

rear-mounted garbage collection trucks have emerged as the ecological guardians of urban environmental hygiene, renowned for their efficiency and convenience. This article explores the features of rear-mounted garbage collection trucks and their signific

New Energy Road Sweeper: The Intelligent Guardian of Urban Sanitation

In the realm of urban road cleaning, an efficient and eco-friendly new energy road sweeper plays a vital role. To meet the demands of urban environmental protection, the emergence of new energy road sweepers has become indispensable for municipal sanitati

Four-Wheel Leaf Collection Truck Leading the Green Sanitation Revolution

As Arbor Day approaches, a new type of four-wheel leaf collection truck is gaining popularity on the streets. This vehicle not only solves the problem of difficult autumn leaf collection and transportation but also receives widespread acclaim for its uniq

Multifunctional Street Washer Truck by North Control Urban Group

With the rapid acceleration of urbanization, the restoration and maintenance of urban environments have become urgent priorities. In this process, the efficient use of sanitation tools and equipment is crucial. Recently, a brand-new multifunctional Stree

Lueyang County Launches Small Rear-loading Garbage Truck Initiative

we are fortunate to see that a new environmental sanitation tool has officially appeared and injected a strong impetus into the environmental sanitation cause of Luyang County in Hanzhong City - that is, Hanzhong rear-loading garbage pickup truck.

Compact mini fuel road sweeper BY-S750

Compact mini fuel road sweeper BY-S750 is a multifunctional road sweeper with articulatedchassis. The cab is panoramic glass structure equipped with air conditioning, and the recovery box ismade of aluminum alloy material. It is a suction cleaner.

Rear-loading garbage truck: New front, more beautiful shape!

Embrace the future of urban waste management with our innovative rear-mounted garbage collection vehicle. As cities prioritize cleanliness and environmental aesthetics, traditional waste collection methods fall short of meeting modern demands.

Advanced Street Washer Truck: Property and Scenic Road Sanitation

four-wheel multi-functional street washer truck has emerged. With its various high-pressure cleaning modes and advanced design, this vehicle becomes a professional assistant for property and scenic road sanitation.

New Energy Street Sweeper: The Green Guardian of Municipal Sanitation

new energy street sweepers has become a reliable guardian for municipal road cleanliness. This vehicle not only complies with national policies on new energy vehicles but also injects green power into urban environmental sanitation with its advanced desig

Side-loading garbage collection truck: Simple operation, large carrying capacity

Traditional methods of garbage collection not only have low efficiency but also result in environmental pollution and resource wastage. Therefore, to better address this challenge, a brand-new side-loading garbage collection truck has emerged, completely

Smart Side-Load Garbage Vehicle: A Green Solution for Communities

with waste management being a prominent concern. To address the issue of waste disposal more effectively, an advanced side-loading garbage collection vehicle has emerged as a reliable assistant for waste transfer in these areas.

New Energy Leaf Collection Vehicle: Innovatively Designed Lightweight Solution

In recent years, with the increasing awareness of environmental protection, there is a growing demand for urban greenery and cleanliness. In order to efficiently and environmentally address the issue of fallen leaves in cities, a brand-new lightweight new

Electric Street Sweeper: Advanced, Efficient, and Safe

The electric street sweeper is an advanced cleaning tool capable of swiftly completing cleaning tasks, outperforming traditional cleaning methods and suitable for various environments.

Manual Push Leaf Collector: A New Tool for Liberation in Greenbelt Cleaning

fallen leaves also pose a considerable challenge to urban sanitation efforts. To efficiently address this issue on the ground, the manual push leaf collector has emerged as an expert in collecting fallen leaves.

Small Three-Wheel Watering Truck: Tool for Property, Scenic Areas, and Gardens

Firstly, the small three-wheel watering truck​ adopts a lightweight and highly maneuverable three-wheel structure. This design not only allows the vehicle to navigate easily through busy city streets but also enables flexible operation in narrow garden ar

Modern Urban Sanitation Weapon – Fully Electric Street Sweeper

In the course of urban development, environmental hygiene has always been a critical task. To more effectively address the cleaning and maintenance needs of city roads, the fully electric street sweeper has emerged as a modern urban sanitation tool.

Optimizing City Streets: The Impact and Efficiency of Electric Street Sweepers

To keep the streets clean and tidy, it is essential to rely on the joint maintenance and care of residents, supported by cleaning tools such as sanitation workers and electric street sweepers.

The Eco-Friendly Impact of New Energy Road Cleaning Vehicles

the new energy road cleaning vehicle has emerged as a powerful assistant for road maintenance and cleanliness. With its unique design and advanced technology, this vehicle provides a fresh solution for urban environmental upkeep.

Winter Maintenance and Care for Electric Street Sweeper

As the temperature gradually drops, the cold winter is approaching. For places such as factories, properties, stations, scenic spots, and other locations utilizing electric street sweepers, timely winter maintenance and care for these vehicles become espe

Pure Electric Road Sweeper: The Eco-Friendly Tool for Road Cleaning

Inthebustlingstreetsofcities,roadcleanlinessremainsanindispensabletask.Tomoreeffectivelyaddressthischallenge,thepureelectricroadsweeperhasemergedasaneco-friendlytoolforro

New Energy Multi-Function Urban Cleaning Road Washer Vehicle

brand-new multifunctional road washer vehicle has emerged as a robust assistant in urban sanitation. This compact vehicle, with its flexible operation and pure electric new energy features, not only ensures environmental friendliness but is also licensabl

Versatile Electric Sanitation Sweeper: Efficient Cleaning for Diverse Environmen

The electric sanitation sweeper​ has a wide range of applications, featuring simple operation, and can be extensively used in municipal roads, factories, workshops, parks, scenic areas, old city districts, urban streets, warehouses, hotels, airport termin

The Small Three-Wheeled Water Sprinkler Truck:Urban Cleanliness Assistant

This ingenious design of the small three-wheeled water sprinkler truck​ encompasses multiple water spraying modes, enabling outstanding performance in various scenarios. Firstly, it is equipped with a precision nozzle spray function, allowing precise loca

Electric Three-Wheeled Road Waher Vehicle: A New Green Cleaning Option

In today's society, environmental sustainability and cleanliness have become integral aspects of people's lives. To meet the demands of this era, a new mode of transportation—the Three-Wheeled Road Washer Vehicle—has emerged. This vehicle boasts numerous

New Energy-Powered Street Sweepers Cleansing the Urban Landscape

all-electric street sweeper has emerged as a professional force in road maintenance and cleanliness. With its compact size, easy operation, and eco-friendly efficiency, this vehicle has sparked a clean 'green revolution' in the city.

Pure Electric Water Sprinkler Trucks in Urban Environmental Sanitation

On the bustling streets of the city, a novel environmentally friendly mode of transportation is gradually making its mark: the pure electric water sprinkler truck. This vehicle not only plays a proactive role in cleaning and sanitation but also stands as

Efficient Oil Stain Removal: High-Temperature Pressuren Street Washers

To effectively tackle these stubborn oil stains, the high-temperature, high-pressure road cleaning vehicle has emerged as a reliable cleaning assistant.

Baiyi-S13 Electric Street Sweeper​ Field Case

Electric Street Sweeper is a strong dust control, suction sweeping one of the automatic sweeper, suitable for indoor and outdoor environment widely used, it is mainly used in parks, squares, residential areas, property companies, logistics parks,

A small electric road sweeper Baiyi-S13 cleans the car plaza

The device uses sweeping, vacuuming, sprinkling three-in-one design, can easily handle common dust, fallen leaves and other garbage. The driver only needs to turn on the small electric road sweeper to efficiently complete the cleaning and maintenance of

Road Washer Vehicle: A Vital Tool for Urban Development

Four-wheeled Road Washer Vehicle has emerged. This vehicle not only efficiently removes various stains from roads but also comes equipped with versatile operating modes suitable for different environments, becoming an invaluable asset in urban environmen

Urban Cleaning Solutions: Embracing Electric Road Clean Vehicles

small road cleaning vehicle has emerged, garnering widespread attention and acclaim for its eco-friendly and efficient features. One of the core features of this cleaning vehicle is its use of lithium iron phosphate batteries as a power source, enabling c

Optimized Urban Cleanup: The Efficiency of Advanced Leaf Collection Vehicles

To facilitate a quicker and more effective leaf collection process, an innovative three-wheel drive leaf collection vehicle​ has emerged. This vehicle is specifically designed for municipal sanitation and scenic area leaf collection. It not only maneuvers

Small electric water truck ready to be sent to France

Four-wheel electric water truck is a new product developed by our company for property, gardens, factories, universities, construction sites and other places. The water tank capacity is 2000L. The vehicle uses battery as power, economic and environmental

Small electric road sweeper customized by South Korean customers

Small electric road sweeper​ customized by South Korean customers is ready to be loaded and shipped to South Korea.Small electric cleaning vehicle is a collection of washing, sweeping, suction in one of the sanitation cleaning equipment. The car subverts

Handover Ceremony for Small Electric Road Garbage Trucks Held in Vietnam

Last month, electric compact garbage trucks​ dispatched to Vietnam were part of a handover ceremony, now actively engaged in waste collection in the country. These all-electric waste removal vehicles are designed for rear-loading, equipped with scrapers f

Custom Electric Street Washer Vehicle shipped to Saudi Arabia

TheElectricStreetWasherVehiclecustomizedbyaSaudienvironmentalcleaningcompanyhavebeencompletedintherelentlesseffortsoftheworkers.TheexteriorcolorofthesenewlyshippedElectric

Custom electric leaf collection tricycle delivery

The compact driver-operated leaf collection vehicles​ are being shipped in bulk, featuring hybrid power systems for simplicity in operation, a novel appearance, compact size, and impressive maneuverability. These vehicles are equipped with functions for

New Energy Leaf Collection Vehicle: Eco-Friendly & Multi-functional

the new energy leaf collection vehicle has captured attention due to its outstanding performance and multifunctional design. This vehicle efficiently collects leaves during the fall season and transforms into a high-pressure washing vehicle during other t

Electric Compact Road Sweeper

Discover the Electric Compact Road Sweeper, a battery-powered solution for economical and environmentally friendly operations. Swift transition speeds and exceptional maneuverability redefine traditional sweepers, overcoming issues like

Utilizing Small Rear-mounted Garbage Transport for Property Streets' Waste

This small rear-mounted garbage transport vehicle utilizes manganese steel cold riveting process on a light truck chassis, equipped with standard automotive tires and shock absorbers, resulting in strong load-bearing capacity and a compact body. It is als

New Energy Pure Electric Sweeper: The Future Choice for Urban Cleaning

the new energy pure electric sweeper has emerged as the future choice for urban cleaning. This compact vehicle can perform high-pressure cleaning operations on busy city streets, enhancing the quality of the urban environment. It is not only environmenta

Small-Sized Pure Electric Cleaning Vehicle: Crafting an Efficient Urban

The one-touch operation design of this small-sized pure electric cleaning vehicle simplifies tasks significantly, making it stress-free even for drivers with minimal experience. The single-person cabin design not only enhances the operator's work efficien

Small Water Sprinkler Truck: A Reliable Aid in Road Maintenance

the four-wheeled small water sprinkler truck has become an indispensable specialized vehicle, providing robust functionality and flexible operation as an effective assistant in road maintenance through watering. This unique design of the small water spri

Electric Road Sweepers Were Sent Overseas

Recently, a shipment of 10 small electric washing and sweeping vehicles was dispatched overseas. This batch comprises the latest models, showcasing a newer design compared to the previous versions. The updated models boast a more fashionable appearance

Transforming Urban Environments: Three-Wheel Street Cleaning Vehicle

Three-Wheel Street Cleaning Vehicle​ incorporates various operation modes such as side washing, frontal washing, backwashing, and handheld water gun washing. This multifunctional design makes cleaning work more flexible and diverse, allowing for the selec

Modern Property and Scenic Area Small Electric Waste Collection Vehicles

Embracing pure electric power, these rear-loading small waste collection vehicles ​eschew traditional fuel engines, significantly reducing environmental pollution. The use of electric propulsion systems renders these vehicles more eco-friendly, aligning

The small electric road washing vehicle is shipped to Longkou

In recent years, urban environmental sanitation has become one of society's focal points. In this context, the emergence of small three-wheeled street washer vehicles ​has proven to be a capable aide in urban environmental sanitation construction.

Electric Garbage Truck for Property and Commercial Streets

this electric self-loading garbage truck​ presents an innovative and efficient solution to the waste management challenges faced by property and commercial streets. Its environmentally friendly and noise-conscious design aligns with the evolving needs

Self Propelled Leaf Vacuum:An Effective Assistant in Urban Sanitation

Amidst the hustle and bustle of the city, as seasons change, leaves fall year-round, bringing both a touch of nature's color and a sanitation challenge. To address this efficiently, a Self Propelled Leaf Vacuum has emerged as a reliable assistant in urban

Green Urban Solutions: The Eco-Friendly Charm of Leaf Collection Vehicles

The charm of the electric leaf collection vehicle lies in its multifunctionality and environmental features. The pure electric power, low noise, dual-person cockpit, and easy operation of this vehicle make it excel in autumn leaf collection and other purp

Efficient Sidewalk Cleaning with High-Pressure Small Road Washing Tricycle

Cleaning the dust on sidewalks and auxiliary roads is time-consuming and labor-intensive. Let's take a look at this High-Pressure Small Road Washing Tricycle! Simple, easy to use, and quick to get the hang of!

New Energy Sanitation Vehicles Shine at the 2023 China Sanitation Expo

On October 19, 2023, the Annual meeting of China Urban Environmental Health Association and China Environmental Health Expo - China Environmental Health Digital Development Conference was grandly opened in Shenzhen.

Small electric eight-bucket garbage transport vehicle has arrived for testing

The Small electric eight-bucket garbage transport vehicle​ is powered by battery, economic and environmental protection, beautiful appearance and atmosphere, mainly used for collecting garbage cans. The vehicle can be loaded with eight 240L standard garb

Pure Electric Street Washer: The Future Choice for Urban Cleaning

the pure electric street washer has emerged as the future choice for urban cleaning. This compact vehicle can perform high-pressure cleaning operations on busy city streets, enhancing the quality of the urban environment. It is not only environmentally

Small Three-Wheeled Driver-Operated Leaf Collection Vehicle

​In urban sanitation work, the accumulation of leaves is often a headache. Traditional cleaning methods are inefficient and can lead to environmental pollution. However, now there is a small three-wheeled driver-operated leaf collection vehicle that is ch

Hybrid Three-wheel Street Washer

Small Hybrid Three-wheel Street Washer, BY-C8, also known as "small high-pressure water sweepers", has multi-functional washing capacity, mainly used for urban sidewalks, side roads, quick washing and cleaning of stone along the road, as well

Efficient and Eco-Friendly Electric Three-Wheeled Sweeper

Pure electric sweeper​ adopts advanced lithium battery technology, which not only contributes to environmental protection, but also reduces the cost of use. Lithium battery not only has a high energy density, but also can provide a long time of life, to e

Pure Electric Street Sweeper: An Eco-Friendly Urban Cleaning Solution

the recently introduced pure electric street sweeper is undoubtedly a significant innovation. This sweeper not only boasts environmental benefits but also prioritizes efficiency and convenience in urban cleaning, making it a valuable ally in maintaining t

Electric Garbage Transfer Vehicle: A Future Eco-Friendly Choice!

This pure electric garbage transfer vehicle is powered by batteries, emitting zero emissions. It not only reduces air pollution but also contributes to improving the surrounding environment's quality. Its presence turns garbage transfer into a part of

Electric four-classification garbage pickup truck loading and delivery

​Four types of garbage pickup truck, dedicated to the urban sanitation system of garbage classification, transportation and transfer tasks. This truck is battery-powered and has the characteristics of economy, environmental protection and beautiful appear

Electric Street Washers: Green Sanitation Revolution

the Four-Wheel Multifunctional Electric Street Washers. This green force in the environmental sanitation industry is bringing about a transformation with its pure electric, cost-effective, and environmentally friendly features, coupled with the advan

Street Washing Vehicle: A New Choice for Environmental Cleaning

The four-wheel multifunctional street washing vehicle​ not only possesses street washing capabilities but also offers multiple operating modes to meet various environmental cleaning needs. This versatility makes it a highly adaptable tool capable of handl

​Electric Rear-loading Garbage Truck: An Environmental Revolution

the pure electric rear-loading garbage truck has emerged as a revolution in the waste transfer industry. This low-noise, high-efficiency electric garbage truck not only facilitates the convenient disposal of waste for property management, scenic areas, an

Pure Electric Four-Wheel Water Sprinkler: Modern Urban Cleanup Powerhouse

The pure electric four-wheel water sprinkler​ utilizes the latest electric technology and is equipped with a powerful battery system, providing reliable power support for water spraying operations. This electric power is not only environmentally friendly

Electric Road Sweeper: A Clean, Efficient, and Intelligent Future

Electric road sweepers use electricity as their power source, eliminating the pollution associated with traditional fuel-powered vehicles. This means they do not emit harmful exhaust gases during the road cleaning process, reducing air pollution and green

Innovative Solution: Three-Wheeled Leaf Collection Vehicle

the three-wheeled leaf collection vehicle. This leaf collection vehicle's design is ingenious, providing city management departments with an efficient, environmentally friendly, and easy-to-operate tool. Below, we will delve into the features and advanta

Small Electric Garbage Trucks Transform Community Cleanup

Theemergenceofsmallelectricgarbagetrucksincommunitiesindeedoffersnumerousadvantagesandconvenienceinaddressingthechallengeofwastetransferwithinresidentialareas.Hereisasummar

Multi-Functional Leaf Collection Vehicle: The Autumnal Marvel of Sanitation

leaf collection vehicle has emerged as a seasonal marvel, providing convenience and efficiency to sanitation work. This leaf collection vehicle not only boasts multiple leaf collection modes but also caters to various sanitation requirements. Whether in t

New Model! Multi-Functional Street Washing Vehicle BY-C6

Asurbanizationcontinuestoadvance,sanitationoperationsplayacrucialroleinmaintainingcleanlinessandaestheticsinurbanenvironments.Inthiscontext,thenewlylaunchedmulti-functionalhi

Revolutionizing Urban Cleaning with the Baiyi-CS60 Electric Wash-Sweep Vehicle

The Electric Wash-Sweep Vehicle Baiyi-CS60 vehicle excels in both standalone and collaborative cleaning tasks. With versatile applications, from narrow streets to large areas, it offers enhanced features like extended arm for high-pressure cleaning.

Advantages of the Electric Small Rear-Loading Garbage Collection Vehicle

The Electric Small Rear-Loading Garbage Collection Vehicle presents a transformative solution. Its agility, low noise, strong capacity, and prevention of secondary pollution redefine waste management. Backed by comprehensive support, it enhances community

Customized Multi-Functional Street Washing Machine with Side Brush

Versatility is a key highlight of this street washers machine​. Its side brush function allows the vehicle to clean one side of the road while in motion, handling snow, dust, and fallen leaves with ease. The high-pressure washing system takes cleaning to

Innovative Urban Sanitation with Compact Electric Ride on Sweeper

pure electric ride on sweepers signifies a crucial step towards a cleaner and greener urban landscape. The introduction of pure electric single-operator sweepers with their impressive performance, user-friendly operation, and multifunctional features is

The All-Electric Road Deep Cleaning Vehicle Shipped to Inner Mongolia

"The Pure Electric Deep Cleaning Vehicle​ and Electric Small Washing and Sweeping Vehicle , both have been sent to a sanitation company in Inner Mongolia. These two models are improved and upgraded versions after several updates and iterations, featu

Precautions for Operating a Small Electric Floor Sweeper

Correctly operating a small electric floor sweeper not only extends the machine's lifespan but also enhances work efficiency, achieving optimal results. Therefore, logistics managers and cleaning personnel should have a proper understanding of the operati

Electric Ride-on Sweepers Maintain a Clean Park Environment

Amidst the tranquility of the park, a novel technological product is quietly playing a crucial role — the electric ride-on sweeper. Serving as the park's guardian, this machine maintains the cleanliness and order of the park, crafting a serene environment

Leaf & Litter Vacuums: The Greening Tool Enhancing Cleaning Efficiency

a powerful Leaf & Litter Vacuums has emerged. Whether in parks, schools, communities, or other public spaces, it has become an indispensable cleaning tool. Renowned for its robust power and versatile applications, the Leaf & Litter Vacuums​ is eq

Street Washing Tricycle: Tackling Sidewalk Cleaning with Ease

Clearing dust from sidewalks and side roads can be time-consuming and labor-intensive. Take a look at this compact and user-friendly Street Washing Tricycle​! It's designed to make sidewalk and side road cleaning easy and efficient.

A Four-Wheel water sprinkler for Road Maintenance in Narrow and Back Streets

Small water sprinklers truck have always been a powerful tool for the sanitation department, but for some narrow sections and back alleys, large sprinklers cannot enter, which brings troubles to the road maintenance of property communities. A four-wheel m

An environmentally friendly and efficient garbage collection vehicle

With the continuous development of society and the gradual increase of people's environmental awareness, garbage disposal has become a prominent issue. In this context, the pure electric rear-loading garbage collection vehicle has brought unprecedented

Clean Revolution: New Energy High-Pressure Wash Vehicles

With the continuous advancement of technology and the increasing awareness of environmental protection, the new energy high-pressure washing vehicle is gradually emerging as a star in the modern cleaning field. Its outstanding performance and multifunctio

New energy electric sweeping vehicle: cleaning and environmental protection

This new energy electric sweeping vehicle first shows its significant environmental protection characteristics with its pure electric drive system. Compared with traditional fuel-powered vehicles, the pure electric power system eliminates exhaust emission

The joint operation of electric sweeping vehicles and street washing vehicles

pure electric sweeping vehicles and high-pressure washing vehicles is becoming an innovative initiative, aiming to maintain the cleanliness and tidiness of sidewalks in an efficient and eco-friendly way. This joint operation scheme has several outstanding

Environmental and efficient small pure electric washing and sweeping vehicles

With the continuous progress of society and the increasing awareness of environmental protection, pure electric washing and sweeping vehicles, as a new type of environmental protection cleaning equipment, play an increasingly important role in urban road

Green Sanitation with Pure Electric Leaf Collectors Truck

With the continuous improvement of environmental awareness and urban environment, pure electric leaf collection vehicles have become a beautiful landscape of modern urban sanitation. This kind of environmental protection transportation tool, which integra

Eco-Friendly Small Electric Rear-Loading Garbage Truck

The rear-loading design of this pure electric rear-loading garbage truck​ ensures convenient and efficient waste transportation. It can carry 20-25 standard 240L garbage bins, significantly improving waste collection efficiency and reducing road traffic c

Efficient Urban Sanitation: High-Pressure Street Washing Vehicles

This small drivable high-pressure street washing vehicle is specially customized for the sanitation industry, designed for single-person operation. Its operation is simple and convenient, allowing even sanitation workers without professional technical bac

Yili Factory's Green Future: Electric Washing & Sweeping Vehicles

Firstly, introducing pure electric washing and sweeping vehicles​ is an important green innovation initiative. Thanks to their pure electric drive, the vehicles operate without emissions, smoke, or exhaust, effectively reducing pollution to the environmen

Electric Three-Wheel Hanging Bucket Garbage Truck

Electric three-wheel hanging bucket garbage trucks, also known as electric hanging bucket trucks, find applications in urban streets, factories, schools, hospitals, residential areas, and government institutions. They feature a glass fiber reinforced plas

Clean & Green: The Electric Road Sweeper Vehicle

The small electric environmental sanitation Road Sweeper Vehicle adopts new energy batteries as its power source, making it more eco-friendly. Equipped with front flushing, slant flushing, and lateral flushing devices, this vehicle boasts multiple washin

Shipping of Street washing vehicles and tree leaf collection vehicles!

In addition to street washing vehicles, tree leaf collection vehicles are also invaluable assistants in urban sanitation construction. During the autumn season, a large amount of leaves accumulates on the roads, posing a hazard to the urban environ

Electric Three-Wheeled Road Washer Vehicle Revolutionizes Urban Sanitation

The Electric Three-Wheeled Road Washer Vehicle features a high-quality three-wheeled load-bearing chassis with strong carrying capacity. Equipped with a 700L water tank, it easily meets the cleaning and epidemic prevention requirements of factory areas.

Battery-Powered Tree Leaf Collector Shipment

The battery-powered tree leaf collector truck represents a significant advancement in environmental technology, utilizing battery-driven power for efficient leaf collection. Its cutting-edge sustainable battery system provides reliable energy, ensuring pr

Electric Four-Wheel Road Washing Vehicle Sent Overseas

A Small High-Pressure Cleaning Vehicle Ready for Overseas Shipment, Contributing to Global Sanitation and Hygiene，The pure electric high-pressure cleaning vehicle adopts an electric driving system, producing zero emissions, making it highly environmentall

Small Electric Four-Wheel Watering Vehicle for Narrow Roads and Alleys

The small water truck is an essential vehicle for sanitation departments and a common type of sanitation vehicle. When it comes to water trucks, many people think they are only used for watering. However, that's not the case. Small water trucks​ have a wi

Electric High-Pressure Washer: Ideal for Factories

Is the Cold and Hot Water High-Pressure Washing Vehicle Suitable for Factories? In many factory areas, stubborn oil stains are often found on the roads and workshops, making cleaning a challenging task. Over time, these oil stains accumulate dust, grea

Advantages of Pure Electric Sanitation Vehicles: A Cleaner and Greener Solution

Pure Electric Sanitation Vehicles: Advantages and Applications Similar to new energy passenger cars, pure electric sanitation vehicles produce no emissions and operate quietly, making them eco-friendly and suitable for various locations. By adopting n

The Eco-Friendly Solution of Pure Electric Rear-Loading Garbage Truck

we present a pure electric rear-loading garbage truck designed specifically for efficient waste transportation within waste stations. Now, let's take a closer look at this pure electric rear-loading garbage truck.​

Efficient Hang-On Garbage Collection Vehicle for Communities and Scenic Spots

Manysanitationworkersfacevariouschallengeswhencleaningroadsidegarbagebins.Transportingthebinsbackandforthcanbetime-consuming,especiallyonpoorroadconditions.Leavingthebinsin

Small Electric Cleaning Vehicle: Elevating Urban Image

This small electric cleaning vehicle​ revolutionizes the traditional sweeping methods by adopting a wash and sweep approach, combining sweeping brushes with a central cleaning and suction device. The synchronous wash, sweep, and suction process eliminates

Three-Wheel High-Pressure Cleaning Vehicle: A Changer for Urban Sanitation

In communities, properties, sidewalks, commercial streets, and food streets, challenges like sanitation blind spots, overly wide or narrow roads hinder the entry of conventional sanitation equipment. However, this efficient three-wheel high-pressure clean

How Pure Electric Deep Cleaning Vehicles are Revolutionizing Urban Cleaning

With the development of society and the improvement of people’s environmental awareness, traditional fuel-powered cleaning vehicles have gradually been questioned. In this context, pure electric deep cleaning vehicles have emerged, becoming a shining star

Combatting Dust Pollution: The Rise of Three-Wheeled Electric Sprinkler Trucks

The advantages of these three-wheeled pure electric sprinkler trucks extend beyond their environmental friendliness. They also possess excellent maneuverability and flexibility, making them suitable for road maintenance in residential areas.

Four-Wheel High-Pressure Cleaning Vehicle for Environmental Sanitation

The user's message is about a four-wheel high-pressure cleaning vehicle ​that can easily shuttle through sidewalks, non-motorized lanes, gaps between sidewalk isolation piers, and gaps between trees. The vehicle is made of cold-rolled precision steel mat

The Future of Urban Cleaning: Pure Electric Deep Cleaning Vehicles

Withthedevelopmentofsocietyandtheimprovementofpeople’senvironmentalawareness,traditionalfuel-poweredcleaningvehicleshavegraduallybeenquestioned.Inthiscontext,pureelectricdeep

Revolutionizing Garbage Transportation: New Energy Small Garbage Truck

The main feature of the new energy small garbage truck is environmental protection. Compared with traditional fuel-powered garbage trucks, the new small energy garbage truck​ uses pure electric new energy batteries as the driving force to achieve zero emi

Revolutionizing Road Cleaning with Electric High-Pressure Vehicles

Electric four-wheel high-pressure cleaning vehicles are indeed revolutionizing road cleaning. The traditional manual road cleaning methods are not only expensive but also yield unsatisfactory results. The expenditure on manual cleaning amounts to hundreds

Efficiency Boosted by Pure Electric Street Sweeper Vehicles

pure electric road sweepers​ that can be licensed have emerged as a powerful tool for urban cleaning. This new type of sweeper uses pure electric drive, zero emissions, low noise, and provides a new solution for improving the urban environment. This pure

Small electric eight-barrel garbage collector truck shipped

The electric eight-barrel garbage collector truck ​is a simple and generous garbage bin transfer vehicle powered by new energy batteries. The vehicle is equipped with a brand hydraulic lift tail plate with strong power, and can lift two 240L garbage bins

Residential Waste Management: The Electric Garbage Collection Vehicle

Although the traditional method of directly loading trash cans onto garbage collection vehicles for transfer is fast and convenient, it leaves gaps in the trash cans in residential areas, causing inconvenience to residents’ lives. If sanitation workers po

Innovative Sanitation: The Multifunctional High-Pressure Cleaning Vehicle

The sanitation four-wheeled high-pressure cleaning vehicle is a compact vehicle that can easily navigate through sidewalks, non-motorized lanes, gaps between sidewalk isolation piers, and gaps between trees. The vehicle is made of cold-rolled fine steel a

The multifunctional high-pressure cleaning vehicle is a versatile and effective

What is a multifunctional high-pressure cleaning vehicle? A multifunctional high-pressure cleaning vehicle is a daily road high-pressure flushing and cleaning equipment, also known as a water sweeping vehicle. This equipment is widely used in the era of m

A Suitable High-Pressure Cleaning Vehicle for Residential Properties

However, large-scale high-pressure cleaning vehicles​ are often bulky and impractical for operations within residential areas, not to mention their high cost. So, what should a high-pressure cleaning vehicle suitable for residential properties be like?

Enhancing City Streets: The Power of Electric Road Sweepers

Street electric road sweepers, also known as electric cleaning vehicles, electric sweepers, road sweepers, or garbage sweepers, are primarily powered by electricity. They are small in size and mainly operate on various streets, sweeping away dust, leave

Hand-pushed leaf collector: innovative professional equipment for autumn

a new hand-pushed leaf collector​ has emerged. This hand-pushed leaf collector is a professional equipment designed to improve the efficiency and convenience of autumn leaf collection. It has two modes of self-propelled walking and hand-pushed walking, wh

Where is the electric road sweeper easy to use?

Is the electric road sweeper easy to use? Companies that have never used a sweeper will always have this question. Here, Anhui Jiebaili will answer everyone uniformly, it is easy to use. Next, I will explain.

Electric Road Sweepers: Assisting in Environmental Cleaning Work

Electric road sweepers are efficient, economical, and environmentally friendly cleaning tools commonly used for cleaning large public places such as high-speed rail stations, factory workshops, municipal roads, parks, and schools. As people’s requirements

Leaf Collection Vehicle - A Specialized Vehicle for Collecting Fallen Leaves

In today’s era, as we pursue environmental sustainability, we urgently need innovative solutions to address the problems brought about by urban greening. To meet this demand, we have introduced a brand new pure electric four-wheeled leaf collection vehicl

Small Fog Cannon Watering Vehicle for Scenic Areas

To address this issue, many scenic areas have introduced small dust suppression fog cannon watering vehicles. What are the characteristics of these vehicles, and are they suitable for use in scenic areas?

Small Three-Wheeled High-Temperature High-Pressure Cleaning Vehicle

The small three-wheeled high-temperature high-pressure cleaning vehicle​ is built on a branded three-wheeled chassis with an integrated curved beam. It uses new energy batteries for propulsion and is equipped with an imported American Brute engine and an

Efficient Cleaning with the Park Road Washing and Sweeping Vehicle

The park road washing and sweeping vehicle​ is a small sanitation vehicle built on a cold-riveted, load-bearing chassis. It is equipped with a high-suction negative pressure suction cup and two large brushes on either side of the vehicle. Each brush is eq

Electric Road Sweepers with Undercarriage Sanitation Solutions

Pure electric road sweeping vehicles are environmentally friendly and efficient sanitation equipment, mainly used for cleaning and sanitation at airports, properties, urban streets, parking lots, ports and other places. Compared to traditional fuel-powere

Single-Person Driving Three-Wheeled Two-Category Garbage Truck

"Environmentallyfriendlyandefficientsingle-persondrivingthree-wheeledtwo-categorygarbagetruck,protectingtheenvironment,startingfromgarbagecollectionWiththeaccelerationofurbanizatio

Residential Waste Sorting Made Easy with Electric Garbage Vehicles

Currently, with the strengthening of environmental protection concepts and the promotion of waste sorting and recycling, many cities have implemented policies on waste classification. Among them, waste sorting in residential areas is of utmost importance.

Compact Four-Wheel High-Pressure Cleaning Vehicle: Instant Road Cleaning

The Compact Four-Wheel High-Pressure Cleaning Vehicle​ is a new vehicle model derived from the multifunctional high-pressure cleaning vehicle and three-wheel high-pressure cleaning vehicle. This compact vehicle features a small size, flexible steering, an

Introducing the Pure Electric Leaf Collection Vehicle

If the fallen leaves are not promptly addressed, they can cause blockages in drainage systems and accumulation in rivers. To reduce the labor intensity of sanitation workers, it is imperative to develop and promote pure electric leaf collection vehicles.

High-pressure cleaning vehicle for road maintenance in a Shandong scenic area

Recently, a certain scenic area in Shandong has procured a multi-functional high pressure cleaning vehicle for road cleaning and maintenance at the entrance of the scenic area. This initiative aims to address the challenges posed by the large influx of vi

Small Rear-Mounted Garbage Collection Vehicle Enhancing Waste Transportation

With rapid urbanization, garbage collection has become an urgent problem that needs to be addressed. To efficiently and environmentally handle household waste, the small rear-mounted garbage collection vehicle has emerged. This vehicle model features a st

The Efficient and Convenient Three-Wheel Drive Leaf Collector

The Three-Wheel Drive Leaf Collector Vehicle​ is equipped with a user-friendly driving operation system, allowing anyone to easily handle it. With simple learning and training, drivers can quickly master the driving skills of the vehicle. Whether it's a p

The benefits of using high-pressure cleaning trucks for various purposes

In the current urban environmental protection, the common ones are sprinkler trucks, flushing trucks, sanitation trucks, etc. Among these sanitation trucks, high-pressure cleaning trucks are often used in urban cleaning. The use of high-pressure cleaning

Electric garbage collection vehicle battery tips

The battery is an important part of the electric garbage collection vehicle. Without the battery, the vehicle has no power and naturally cannot move. It can be said that the importance of the battery for the electric garbage collection vehicle​ is unquest

Pure electric sanitation vehicles: the urban eco-friendly choice

Pure electric sanitation vehicles​ use electric motors to drive when traveling and working, which emits much less noise than traditional fuel vehicles, effectively reducing noise pollution to the environment. At the same time, it also reduces the internal

Electric Street Washer Vehicles for Back Alley Cleaning

Sanitation Electric Street Washer Vehicles​ adopts load-bearing three-wheel chassis, strong load-bearing capacity, and can enter the working mode with one key, simple operation, ordinary workers can quickly get started. The vehicle is small and flexible,

Electric Road Sweepers: A Powerful and Convenient Cleaning Solution

Electric road sweeper​ has low cost and high cleaning efficiency The electric road sweeper has two side brushes on both sides. When the sweeper moves forward, it can sweep the dust, fallen leaves and other garbage on the road to the middle, and then use t

Small four-wheel electric sanitation vehicle for urban garbage transfer

Small four-wheel electric sanitation vehicle for urban garbage transfer ​adopts pure electric drive, no emission, no noise, energy saving and environmental protection, in line with the national requirements of energy saving and emission reduction, and als

Electric deep cleaning vehicle is cleaning road markings at the customer's site

The electric deep cleaning vehicle​ is a highly specialized and targeted all-electric compact sanitation vehicle. Its primary function is to perform in-depth surface cleaning on urban main and secondary roads, sidewalks, auxiliary lanes, parks, scenic are

A New Energy Sprinkler Vehicle for Logistics Industrial Parks

new energy sprinkler vehicles suitable for logistics industrial parks have also become the focus of attention. Due to the frequent entry and exit of vehicles in the logistics park, the road surface often has dust problems, and due to the different types o

Small Electric Washing and Sweeping Vehicle for Road Cleaning in the Hot Summer

The biggest feature of the small electric washing and sweeping vehicle​ is that it subverts the traditional sweeping vehicle’s operation mode and changes dry sweeping to washing and sweeping. The side brush cooperates with the central negative pressure wa

Cleaning with a Four-Wheel High-Pressure Washer Vehicle

a four-wheel multifunctional high-pressure washing vehicle came into being. This vehicle not only has various functions (side flush, row flush, counter flush, high-pressure gun flush, and dust suppression), but also can be customized, single-person drivin

The Benefits of Self-dumping Garbage Trucks for Community Cleaning

Self-dumping garbage trucks have become a common garbage cleaning equipment in communities, and many communities use this type of vehicle to carry out garbage collection and transportation work. In residential communities, there is a lot of domestic garba

The Advantages of Electric Washing and Sweeping Vehicles for Airport Cleaning

so many airports choose to introduce electric washing and sweeping vehicles to replace manual airport cleaning operations. So what are the characteristics of electric washing and sweeping vehicles, suitable for airport use?

The Features of Hand-pushed Leaf Suction Machine for Campus Cleaning

In fact, this problem can be solved by using this hand-pushed leaf suction machine. Aiming at the problem of leaf collection, the manufacturer keenly discovered this sanitation problem. After intensive research, they created such a series of products that

Small Sanitation Vehicle with High-Pressure Cleaning

Small high-pressure cleaning vehicle ​is a sanitation operation vehicle that uses a brand frame and has a small size. The design concept of the three-wheeled vehicle is to make the vehicle easy to drive, easy to operate, beautiful in appearance, and di

Electric Eight-Barrel Garbage Removal Vehicle:Garbage Bin Transfer Vehicle

Electric eight-barrel garbage removal vehicle is a simple and elegant garbage bin transfer vehicle that uses new energy battery power. The vehicle is equipped with a brand hydraulic lifting tailboard with strong power and high load capacity. It can simu

Small Electric Washing and Sweeping Vehicle: Electric Vehicle for Cleaning Alley

the sanitary conditions of the back streets and alleys are more complicated, with many sanitary dead corners. Pure manual cleaning requires a lot of time and labor costs, and the cleaning effect is not very good. Is there a small electric washing and s

Efficient Waste Management: The Electric Community Garbage Collection Vehicle

Fortunately, the use of the small community garbage collection vehicle can easily solve the aforementioned problems. This vehicle is purely electric and equipped with high-quality, maintenance-free lithium iron phosphate batteries, providing fast charg

The Handy Gasoline-Powered Leaf Collector Machine

with the introduction of the innovative Gasoline-Powered Leaf Collector Machine, these issues can now be easily resolved. Regardless of the volume of fallen leaves, regular cleaning ensures a simple leaf collection process and effortless transportation.

Enhance Sanitation Efficiency with Three-Wheeled High-Pressure Cleaning Vehicles

three-wheeled high-pressure cleaning vehicles to "equip" their sanitation teams for the upcoming Dragon Boat Festival holiday. This way, the work can be completed without working late into the night, and the sanitation workers can greet the &a

Addressing Community Dust Issues with the Electric Three-Wheel Water Sprinkler

This compact electric three-wheel water sprinkler vehicle features a load-bearing three-wheel chassis with an integrated curved beam design, providing strong load capacity. It is compact and agile, allowing it to maneuver easily on relatively narrow commu

Efficient and Compact Electric Street Sweeper for Commercial Streets

This small electric street sweeper​ is indeed ideal for commercial street cleaning. Equipped with a sturdy and stable manganese steel light-duty truck chassis and standard automobile tires, this small electric street sweeper has strong load-bearing capac

Compact Four-Wheel High-Pressure Cleaning Vehicle: A Brief Overview

The compact four-wheel high-pressure cleaning vehicle is a small electric environmental cleaning device developed based on market research, as well as feedback and suggestions from sanitation workers. With its robust steel construction, durability, high

Road Sweeping Vehicles: A Modern and Eco-friendly Cleaning Solution

Road sweeping vehicles​, also known as sanitation small cleaning vehicles, sanitation road cleaning vehicles, electric sanitation sweeping vehicles, small sanitation cleaning vehicles, pure electric cleaning vehicles, road vacuum cleaning vehicles. Pure

Three-wheeled High-pressure Cleaning Car: A Multi-functional Application Scenari

Three-wheeled high-pressure cleaning car is a kind of sanitation vehicle that uses high-pressure water flow to clean the ground, wall, guardrail and so on. It usually consists of load-bearing three-wheeled chassis, water tank, high-pressure water pump

Electric Garbage Truck: A Green and Efficient Solution

Electric sanitation garbage truck, also known as pure electric sanitation garbage truck, is a kind of sanitation equipment that is different from fuel type. It does not emit exhaust gas, does not damage the environment, and has low noise. It has short

Industrial Sweeper Advantages

The performance of the industrial sweeper is strong and stable, and it has a strong cleaning ability. It can adapt to all kinds of harsh places and is loved by factory users. In addition to these basic performance advantages, industrial sweepers​ have ma

Small Electric Three-Wheel Street Washing Vehicles Improve Community Sanitation

The small electric three-wheel street washing vehicle​ uses imported first-line brand engines and Italian AR high-pressure water pumps for the whole vehicle, and the washing pressure can reach 275 kg, which can easily wash away various stubborn stains.

Electric Road Sweepers: A Smart Solution for Urban Sanitation

To keep the streets clean and fresh, it depends on the joint maintenance and care of residents and friends. Relying on the support of cleaning tools such as sanitation workers, electric road sweepers, etc.

Hand-Pushed Leaf Collector: Efficient Leaf Collection for Landscape Management

In autumn, as tree leaves fall one by one, landscaping properties face a significant task of leaf clearance. To improve efficiency and facilitate operations, a Hand-Pushed Leaf Collector has become an invaluable assistant for landscaping properties. This

Pure Electric Small-Sized Street Sweeper: Bringing Cleaner Grounds to the City

In the era of pursuing environmental friendliness and efficient cleaning, pure electric small-sized sweeping and washing vehicles have emerged. Compared to traditional dry sweeping methods, these vehicles possess powerful capabilities for road surface cle

The Ideal Electric Small-Sized Sprinkler Truck for Campus Sanitation

This electric small-sized sprinkler truck​ is highly suitable for campus sanitation use. Considering the narrow campus roads and high pedestrian traffic, this electric small-sized sprinkler truck adopts a lightweight truck chassis with manganese steel

Using Road Electric Sweeper Vehicles for Industrial Park Cleaning

Road electric street sweeper vehicles are a kind of environmental friendly and efficient cleaning equipment, widely used in urban, highway, industrial park and other places for cleaning work. Compared with traditional cleaning methods, road electric sweee

The Benefits of Small Electric Sprinkler Vehicles for Campus Cleaning

and there are more flying catkins and dust in spring, so watering, sprinkling, and dust reduction work require a lot of manpower. Many universities want to introduce sprinkler vehicles instead of manual labor. But the campus roads are narrow, and there ar

The Advantages of Small Electric Sanitation Vehicles for Urban Cleaning

Small electric sanitation vehicles are a kind of sanitation cleaning equipment suitable for urban roads, communities, schools and other places. They use electricity as the driving force, and have the characteristics of lightness, flexibility, energy savin

Electric Street Sweepers: The New Trend of Cleaning Industry

With the need of production development, electric street sweepers can be seen in many places. They have gradually replaced the traditional cleaning methods and become the backbone of the cleaning industry. Electric street sweepers ​have a wide range of

Driving-Type Sweeping Vehicle: A New Solution for City Cleanliness

many enterprises now choose to use driving-type sweeping vehicle to replace the traditional manual cleaning, to solve the city’s cleanliness problem. So, what are the advantages and uses of industrial driving-type sweeping vehicle​?

Small Electric Garbage Truck: A New Type of Sanitation Vehicle

The structure of the small electric garbage truck mainly consists of the frame, the carriage, the motor, the controller, the battery, the steering system, the braking system, the suspension system and so on. The frame is the foundation of the small electr

Four-category Electric Garbage Vehicle: A Green Tool for Urban Waste

The four-category garbage collection and transportation vehicle is a vehicle specially used for garbage classification and transportation. It adopts advanced design and manufacturing technology, which can achieve efficient and convenient operation in

The advantages and market prospects of new energy road maintenance vehicles

new energy road maintenance vehicles will bring new changes to urban road maintenance. This new energy road maintenance vehicle​ has passed the announcement and can apply for a license. This maintenance vehicle has multiple functions such as side flush

Three wheel leaf collection vehicle, small size, simple operation

The three-wheeled leaf collection vehicle is an indispensable artifact in the sanitation operation. It is small in size, simple in operation, and can quickly complete the collection and treatment of fallen leaves. This vehicle uses a gasoline engine, stro

The features and benefits of electric three-wheel sprinklers

The electric three-wheel sprinkler is a new type of low-carbon and environmentally friendly electric sprinkler that does not run on the road. It has strong performance, multiple functions, and comfortable driving. Our most common use is road cleaning, and

The Advantages and Applications of Electric Mini Sweepers

We see that electric mini sweepers have a wide range of applications, such as factory areas, large storage warehouses, municipal units, park squares, etc. They can all use the energy-saving and environmentally friendly electric mini sweeper equipment prod

Where can small four-wheel electric garbage trucks be used?

it also causes a large amount of garbage cans, and sometimes there are no garbage cans available. The rear-loading garbage truck can avoid this problem. So where are small four-wheel electric garbage trucks​ suitable for use? If you are not very clear

Small electric eight-barrel garbage removal vehicle

And the garbage transfer work is also very important, the property park will produce a lot of garbage every day, in the transfer process if there is spillage phenomenon will greatly affect the park image. Is there a garbage removal vehicle that can sol

Rear-Loading Garbage Truck for Community Garbage Removal

The small rear-loading garbage truck is also called self-loading and unloading garbage truck, etc. The main working principle is to hang one or two trash cans on the tractor and use a wireless remote control (optional) for operation. The whole process d

Multi-Functional small four-wheel electric high-pressure cleaning truck

Now using a small four-wheel electric high-pressure cleaning truck​, one person can easily complete the basic cleaning work of a road, and the effect is remarkable without dust and high value.

Electric Four-Classification Garbage Collection Vehicle Arrival Scene

Liaoning Sanitation Company has introduced the Four-Classification Garbage Collection Vehicle for transporting and handling classified waste. This electric-powered vehicle is eco-friendly, visually appealing, and capable of carrying eight standard 240-lit

How Pure Electric Washing and Sweeping Vehicles Improve Urban Environment

These pure electric washing and sweeping vehicles are making a great contribution to the beautiful living environment of the city with their efficient and environmentally friendly characteristics. The shooting location is the urban road within the third

Pure Electric Road Sweeper Vehicle for Urban Sanitation Cleaning

Pure electric washing and sweeping vehicle is a new environmental cleaning equipment that can collect garbage and dust into the vehicle body, making a great contribution to the cleanliness and beautification of the urban environment. In the back streets

Pure Electric Small Garbage Truck, Municipal Property Street Garbage Transfer

Pureelectricsmallgarbagetruckistheidealchoiceformunicipalpropertystreetgarbagetransfer.Thisvehicleusespureelectricdrive,zeroemissions,energysavingandenvironmentalprotection,

How to Choose an Electric Sweeping Vehicle and Get a Factory Price

Thepriceofanelectricsweepingvehicleisaquestionthateveryuserwhobuysanelectricsweepingvehiclecares aboutfirst.Thepriceistoocheap,worriedaboutpoorquality,thepriceis

Electric Sweeping Vehicles for Sanitation in Urban Cleaning

Electric Sweeping Vehicles are small in size and can freely shuttle in back alleys, non-motorized lanes, and sidewalks for cleaning operations. Although it has a small “figure”, it has an efficient sweeping and flushing operation mode, diverse functions

Small Road Sweeping and Flushing Vehicles in Urban Cleaning

Small Road Sweeping and Flushing Vehicles ​are small in size and can freely shuttle in back alleys, non-motorized lanes, and sidewalks for cleaning operations. Although it has a small “figure”, it has an efficient sweeping and flushing operation mode, d

Small Electric Four-Wheel Garbage Collection Vehicle Product Advantages

Small electric four-wheel garbage collection vehicle has been widely used in urban sanitation, urban and rural sanitation, municipal gardens, property cleaning, factories, schools, hospitals and other places.

Road Maintenance Vehicle: A Special Vehicle for Sidewalk Cleaning

Baiyi Electric Road Maintenance Vehicle has a carbon steel material box body with a large-capacity water tank inside, and the water tank is anti-corrosion treated. There are three aluminum alloy rolling shutter doors on both sides and the rear of the bo

Towed Leaf Collector: An Efficient, Safe and Eco-friendly Leaf Cleaning Device

If you often need to clean up a lot of fallen leaves, you may encounter these troubles: too many fallen leaves pile up, occupy space, and are inconvenient to transport; dry leaves and branches are prone to cause fire or other dangers; sweeping a large

Methods to Reduce the Damage of Electric Road Sweeper

The electric road sweeper has become a good helper for urban sanitation, but the following practices should be avoided in use to reduce the damage to the electric road sweeper​

What Can the Electric High Pressure Road Washer Mainly Do

The Electric High Pressure Road Washer flushes the blocked pipe through the strong pressure generated by the high pressure water flow. The main components are tank, high pressure pump, hydraulic system and so on. The principle of the Electric High Pressur

How to Maintain the Small Electric Garbage Truck Motor

Small electric garbage trucks have become a widely used means of transport for daily cleaning, and the motor is a very important part of small electric garbage trucks, so how do we maintain it?

Economical and Practical Electric Driving Sweeper

construction sites have large road areas, and a lot of dust. Some communities have high green coverage and difficulty in leaf cleaning. Manual cleaning costs are high, and cleaning work begins to use environmentally friendly and pollution-free, economi

Electric Sanitation Sweeping Vehicle Product Function Description

Electric Sanitation Sweeping Vehicle also has a dust removal function. There is a high-power fan inside the body, which can suck some small impurities into the trash can, such as paper scraps, melon seeds, fruit shells, dust, etc.

Small Rear-Loading Garbage Trucks Maintenance

small electric garbage truck connection, the main method is also visual, to see that the wiring harness of garbage truck will have wireless skin cracking, loose, poor contact and other phenomena. If there is no, it must represent normal. If there is, it

What are the common faults of three wheel high pressure street washer

As we all know, three wheel high pressure street washer will have such and such failures when used for a long time, which is inevitable, but we can reduce the occurrence of failures through our daily maintenance work. Before this, we need to understand w

How to avoid the electric water sprinkler machine to take teeth

Some understanding of the electric water sprinkler machine car friends, should know that the force is an important part of the sprinkler tank body, but at the same time the force is also very easy to fault parts, when the force is faulty, the direct and o

The electric ride-on sweeper has the function of maintaining the ground

The electric ride-on sweeper has the function of maintaining the ground. It uses high pressure to remove stains and dust by pressurizing ordinary tap water to hundreds to thousands of atmospheric pressures with a high-pressure pump, and then ejects a str

Pure electric high pressure street washer, hand-held spray gun is more useful!

Pure electric high pressure street washer​ is a new type of cleaning equipment, it can quickly clean the pavement, auxiliary road and roadside stone and other ground. The use of such equipment can not only improve the efficiency of cleaning, but also redu

Baiyi-CS60 Fully Enclosed Integrated Sweeper

Fully Enclosed Road Sweeper, is designed for use in cold and harsh environments, making it suitable for various public spaces such as roads, sidewalks, factories, warehouses, residential areas, airports, train stations, ports, parks, and squares.

Small Electric Garbage Pickup Truck Maintenance

Small electric garbage pickup truck​ refers to a vehicle used for municipal sanitation department to transport all kinds of garbage, with reliable quality, low failure rate, easy maintenance, low operating costs, mainly used for transportation of all kind

How to Correctly Operate a Small Electric Garbage Truck

Small electric garbage trucks are very common in our life, but many operators are not particularly familiar with the use of small electric garbage trucks​, there may be some wrong use methods, long-term so, it may cause the small electric garbage trucks p

Working Principle of Electric Street Washer

Electric Street Washer, also known as specialized loose pipe vehicles, work by using the strong pressure caused by high-pressure water flow to flush away sediment and dead corner dirt in pipes on public utilities. Of course, most of the cleaning cars are

Electric Street Washing Truck Is Popular in China

What is the characteristic of Electric Street Washing Truck? Why are Electric Street Washing Truck​ so popular with municipal garden sanitation departments and sanitation workers? 1. This car is relatively small in size and light in weight. It can cut th

Electric Water Sprinkler Truck Oil Replacement of the Four Misunderstandings

Electric Water Sprinkler Truck Oil Replacement of the Four Misunderstandings Any vehicle in driving for a period of time will need to change the oil, but many users in the replacement of oil there are certain misunderstandings, today to list four:

Using Electric High Pressure Washer in Rainy Season

Many electric high-pressure street washing vehicles are used outdoors, and when used outdoors, it is inevitable to encounter special weather. In rainy days, several problems will be encountered when the electric high-pressure washing car works:

A Pure Electric Deep Cleaning Vehicle Cleans the Sidewalk

Pure electric deep cleaning vehicle​ uses pure electric drive, zero emissions, low noise, no pollution to the environment. This vehicle uses advanced technology and has efficient cleaning capabilities. The width of the vehicle is in line with the cleanin

Small Electric Water Spray Tricycle

Small Electric Water Spray Tricycle BY-X15 vehicle is pure electric, economic and environmental protection, the battery uses super Wei maintenance-free battery, a total of 5 71AH, endurance of up to 60 kilometers. In this environmentally conscious age,

Four Wheel Electric Garbage Truck Advantages

Today, let's talk about the advantages of four electric garbage trucks. Four Electric garbage truck​ is a fast electric environmental protection car, pure electric drive, low noise, high efficiency, more environmental protection, that is to ease the labor

Electric three wheel high pressure washing tricycle

Electric three wheel high pressure washing tricycle Functional Characteristics ● The vehicle adopts a heavy electric chassis, brushless DC motor configuration of Italy AR high pressure water pump, with high pressure, low noise, zero emissions.

Pure Electric Road Sweeper to Solve the Road Pollution Problem

Pure Electric Road Sweeper is a kind of environmental protection, efficient sanitation equipment, mainly used in airports, property, city streets, parking lots, ports and other places of cleaning and cleaning. Compared with the traditional fuel washing an

Environmental protection 8 barrel electric waste carrier

8 barrel electric waste carrier is suitable for environmental sanitation, municipal, industrial and mining enterprises, property communities, and residential areas with a large amount of garbage. One car can carry multiple large cars, which can effectivel

Sanitation Electric Sweeper Maintenance

In recent years, the Sanitation Electric Sweeper is becoming more and more popular. The electric sweeper gradually enters various fields of the cleaning industry, such as shopping malls, supermarkets, hotels, underground parking lots, etc., so how should

The Correct Use of Electric Street Sweeper Vehicles

Electric Street Sweeper Vehicles​ are becoming more and more important in our life. The following Xiaobian will introduce the correct use of electric sanitation vehicles: I. Before use: Staff need to be trained, not only in operational specifications

How to Treat the Sewage of the Road Washing Truck

Wash the waste water of small vehicles. Because such vehicles run more short distances, the vehicles are contaminated with more dust and mud and sand, and relatively few oil substances, so this kind of waste water pollutants are relatively single, mainly

Correct maintenance knowledge of electric garbage truck battery

Electric garbage trucks are becoming more and more popular, precisely because of their good performance, but the maintenance of electric garbage truck​ batteries is very important when using them. If the maintenance is not good, the overall life of the

How to extend the battery life of electric garbage trucks

Electric garbage trucks are popular because they are energy-saving and environmentally friendly, but there is one thing that the battery life will be greatly reduced over time. So how to extend the battery life, here are some tips from the editor.

Meet the Multi-functional Dust Suppression Vehicle

Multi-functional dust suppression vehicle​ is a modern green and environmentally friendly product, which has the advantages of energy saving, pollution-free and low noise. It can be used for reducing dust and haze, spraying medicine, sprinkling water, cle

What if the direction of the electric garbage truck fails?

When there are parts in the steering mechanism of electric garbage truck accessories cracked, scattered and stuck, the steering mechanism will suddenly be out of control, causing the driver to be unable to control the steering of the vehicle. The followin

A Simple Introduction to Cleaning High-Pressure Fog Cannon Sweeper

The doors and Windows of the cleaning High-Pressure Fog Cannon Sweeper are made of explosion-proof glass, and the whole vehicle is made of sand spraying process, which is more wear-resistant, anticorrosive and rust proof. And the pre nozzle, the use of hi

The Electric Sanitation Sweeper Helps the Sanitation Cleaning Work

In Jinan street can often see the shadow of the sanitation sweeper, now the road sweeper is generally diesel sweeper, professional drivers are needed to drive. Due to the large body size of diesel road sweeper, it has certain limitations for cleaning the

How to cool the electric street sweeper in summer

Summer is the highest temperature season in the four seasons, how to give your electric street sweeper "cool" in the hot summer? Today let Baiyi give you the popularization of the next summer how to ensure the normal use of sweeper.

Why do electric road sweepers work shorter hours in winter

Friends who have used electric road sweepers​ in winter can basically know that this phenomenon is normal, some people think that the quality of sweeping cars is not good or just bought about a year to contact the manufacturer to replace the battery,

Electric sweepers are used in coal mines

Driving electric sweeper is a new type of cleaning equipment, it uses electric drive, no gasoline, can effectively reduce the pollution of coal mine, improve the environment of coal mine. In addition, it also has the advantages of energy saving, convenien

Six Electric Garbage Trucks Are in Use in Vietnam

Six electric garbage trucks were handed over to the Hue Municipal People's Committee. They are the first electric trucks used for garbage collection in Vietnam

Summer Pure Electric Street Sweeper Dvantages of Roadside Sweeping

This pure electric street sweeper uses manganese steel light truck chassis, with standard car tires, not only strong bearing capacity, but also small and flexible body, can be opened on the sidewalk for operation, will not damage to the floor tile,

Electric Driving Sweeper Can Sweep What Kind of Garbage

The biggest advantage of Electric Driving Sweeper is to replace manual cleaning, its use is sweeping → collecting garbage, leave to be processed later → dust control, daily work, give us the biggest feeling is the road sweeper, sprinkler more, many munici

The use of small leaf collection vehicles

Small leaf collection vehicle is a vehicle dedicated to collecting leaves, which is usually used for leaf collection in gardens, scenic spots, property and other environments. The small leaf collection vehicle has the characteristics of single operation

New Energy Road Sweeper Car on the Market

The New Energy Road Sweeper Car​ has been on the market, which is a vehicle with energy-saving and environmental protection characteristics. There is an announcement, can sign. It uses a new type of new-energy battery, which has a longer service life and

New Energy Road Washing Car on the Market

New Energy Road Washing Car have been announced, and can be licensed. This maintenance car uses side flushing, hedging, high-pressure water gun flushing and other functions, has a one thousand liter water tank, a single tank of water operation time of

Community Four Types of Garbage Transfer Vehicle

The four-classification garbage pickup truck is a kind of vehicle specially used for garbage classification and transportation. It adopts advanced design and manufacturing technology, which can realize efficient and convenient operation in the process of

It Is Very Necessary to Use Small Electric Sweeper in Logistics Park

parks have purchased high-efficiency and energy-saving electric sweepers, which help to clean and solve the problems faced by logistics parks. So, what are the benefits of using electric sweepers ​in logistics parks?

The Functional Characteristics of the Fog Cannon Electric Sweeper

The feature of the fog cannon electric sweeper is that it has many functions. It is very practical in our daily life. We often see him. For example, fog cannon electric sweepers appear on city streets, alleys, park neighborhoods and factory floors. What

Electric Three-Wheel Sprinkler Manufacturers

Electric three-wheel sprinkler​ is my company for property, gardens, factories, universities, construction sites and other places to develop a new product. The vehicle uses battery as power, economic and environmental protection, beautiful appearance atmo

Pure Electric Sweeper! Small Size, Strong Passability

Withtheaccelerationofurbanization,moreandmorepeoplepayattentiontoenvironmentalhealth.Inordertoensurethesanitaryenvironmentofthecity,alargenumberofcleaningvehiclesareneed

Leaf Collection Trucks Work in Conjunction with Electric Street Washer

leaf collection trucks to operate in conjunction with pressure cleaning trucks. A leaf collector is a vehicle specifically designed to collect fallen leaves. It works by suction of fallen leaves through a high-pressure suction under the vehicle. As the v

Small Electric Sweepers Can Improve Factory Efficiency

Small Electric Sweepers​ is driven by electric energy, so it belongs to new energy equipment. Small Electric Sweepers is a sweeper used in industrial sites to clean up garbage. However, it can be used not only in industry, but also in daily life.

Small Three-Wheeled Street Whaser Advantages

Thissmallthree-wheeledhigh-pressurecleaningcarhasgonethroughmanyiterations,andtheproductismatureandstable.Let'stakealookatitsadvantages.Thismulti-functionalhigh-pressure

Airport, Scenic Area, Cement Factory, Factory, School Road Cleaning Solutions

pure electric street sweepers. Indeed, the cleaning of the ground is directly related to the working environment of airports, factories and other closed environments. It is actually very simple to find a pure electric street sweepers suitable for closed

The Seven Advantages of the Sanitation Electric Sweeper Are Reflected

1, intelligent operation control system: sanitation electric sweeper one key control dust collection cleaning system open and close, automatic collision avoidance, avoidance, simple and convenient operation, hydraulic motor drive cleaning brush, providing

The Advantages and Applications of Small Hanging Bucket Garbage Trucks

small hanging bucket garbage truck is that a car can be equipped with dozens of garbage cans, can realize a car and several garbage cans joint operation, circular transportation, convenient use, improve the transportation capacity of the vehicle, especial

Electric Street Washer Vehicles Are Purchased on a Large Scale

Central Clean Company has made a significant purchase of Electric Street Washer Vehicles​, which boast outstanding cleaning performance and versatility, enabling swift and efficient completion of cleaning tasks. With their compact and flexible design,

Residential Property Use of Electric Sanitation Sweeper

Look back - property area suitable for the Electric Sanitation Sweeper Combined with the community environment, and then look at the property community suitable for what kind of sanitation sweeping car.

The Use of Street Sweeper Skills and Matters Needing Attention

Driving Street Sweeper similar to automatic transmission cars, operation and driving generally different, the operation of street sweeper is also technical skills! Moreover, the driving street sweeper​ is now one of the mainstream cleaning equipment, has

3.5 Cubic Rear-Loading Garbage Pickup Truck Property Community Garbage Transfer

Traditional garbage removal vehicles need fuel driven, loud noise, high emissions, not only affect the normal life of residents, but also caused a small impact on the environment. Therefore, the pure electric, low noise, zero emission 3.5 cubic cubic garb

What Is the Role of Electric High Pressure Street Washer

Multi-functional Electric High Pressure Street Washer, also known as "street washer tricycle​" with multi-functional washing operations, mainly used for urban sidewalks and side roads of rapid washing and cleaning, as well as the city small adve

Gasoline Leaf Collector Machine Baiyi-T2

Gasoline Leaf Collector Machine, also known as hand push leaf collector​, is Baiyi environmental protection using the European leaf collection concept, combined with the actual domestic production of a new leaf collection equipment, the equipment is high

Washing, Sweeping, Flushing, Three-In-One Pure Electric Road Washer and Sweeper

including cleaning, flushing, sewage collection, high pressure flushing, but also has low noise, zero emissions and other characteristics. Below, I will give you a detailed introduction to the charm of Electric Road Washer and Sweeper.

Industrial Fully Enclosed Sweeper Advantages

Industrial Fully Enclosed Sweeper has good visual field and simple operation. It helps you clean both indoors and outdoors without worrying about being seen or getting in the way of others. This product is highly flexible and maneuverable, enabling you to

New Products Come Out! New Energy Pure Street Sweeper Car Debut

new energy sanitation vehicles have gradually become a new favorite in the market. In this environment, a new product called "New Energy Pure Street Sweeper Car" of Baiyi also ushered in the market, which has received widespread attention. This

Efficient and Cost-effective: The Benefits of Electric Road Sweepers

In fact, Electric Road Sweepers are practical cleaning equipment. Different models of Electric Road Sweepers​ can be used according to different locations and cleaning needs. They have low cleaning costs and high power, making them a very practical cleani

Pure Electric Rear-Mounted Four-Wheel Garbage Truck

Can be licensed four wheel electric garbage truck ​is Ji 'nan Baiyi comply with the current policy environment, for the large city research and development design of a brand of new energy electric vehicles for the base of the garbage truck, the car can be

Small Electric Garbage Trucks Advantages

The small electric garbage truck is powered by the on-board power supply, and drives the wheel with the motor. It is equipped with double motors for walking and unloading cranes, double systems, and strong power to meet the requirements of unloading and

High Pressure Washer Truck Arrived in Shenzhen Sanitation

the High Pressure Washer Truck assumes the important responsibility of maintaining urban environmental health. However, traditional cleaning trucks often have problems such as loud noise and serious pollution, which affect the quality of life of urban

Baiyi Pure Electric Street Sweeper Arrived at Baiyun Airport

The arrival of Baiyi Pure Electric Street Sweeper will help the construction of Baiyun Airport's sanitation environment and jointly build a beautiful city image. As a Pure Electric Street Sweeper, it can not only effectively wash the airport ground,

Electric Three-Wheel Leaf Collection Vehicle Shipment

leaf collection is a very important work. Traditional leaf collection methods often require a lot of manpower and material resources, and low efficiency. Now, a new tool called the Electric Three-Wheel Leaf Collection Vehicle ​ offers a more convenient

Scope of application of electric three-wheel sweeper

Sweeper is divided into electric three wheel sweeper and four wheel road sweeper, three wheel and four wheel range of application is different, three wheel sweeper is mainly suitable for schools, squares, stations and other small environmental workplaces.

Revolutionizing Urban Sanitation with Electric Road Sweepers

In fact, this problem can be solved through coordinated operation of this pure Electric Road Sweeper and a large road sweeper. The pure electric wash sweeper is equipped with a lightweight truck chassis made of manganese steel cold riveting and splicing

Small three-wheel water truck good helper

Small three-wheel water truck with a variety of sprinkling mode optional, can meet the needs of different sanitation operations. In terms of road sprinkling, small three-wheel water trucks can provide post-sprinkling and anti-aircraft cannon sprinkling +

What are the advantages of small rear loading garbage trucks?

small rear loading garbage truck are more impressive. Compared with the traditional gasoline version of the garbage truck, the small rear load garbage truck has many advantages, especially in the narrow community road performance is more prominent. First

A Powerful Tool for Collecting Leaves - Shredded Leaf Collector

The leaf collector with shredder, also known as a towed leaf collector, is a machine designed specifically for collecting leaves. It is equipped with an 18HP lead-free gasoline engine from Briggs & Stratton, but it doesn't have its own driving power.

Small electric street washer tricycle customized appearance has been loaded

Recently, the small electric street washer tricycle​ customized by a sanitation company, the appearance of color, under the unremitting efforts of workers to complete the customization, facing the first ray of sunshine in the morning loading and shipping.

3 Cubic Meters New Energy Electric Street Sweeper

Pure electric street sweeper​ is widely used in municipal roads, residential areas, squares, schools, hospitals, ports, docks, industrial plants and other places of cleaning work

Electric Street Washers to Adapt to a Variety of Working Scenarios

the four-wheel multifunctional Electric Street Washers is undoubtedly a very excellent cleaning equipment, with a variety of superior characteristics. First, the cab of the four-wheel multifunctional pressure washer is safer. The design of this cleaning

What Kind Of Garbage Can A Road Sweeper Sweep?

What kind of garbage can a Road Sweeper sweep? Many people think that electric sweepers can only sweep the floor. Dust and other garbage, but some garbage cleaning effect is not good, so have been hesitant to buy electric road sweeper​.

Sanitation Small Electric Road Sweeper

Sanitation Small Electric Road Sweeper can be unlimited time unlimited location, only one person driving, saving personnel costs at the same time, but also reduce the pollution and injury brought to the personnel in the cleaning process, automatic cleanin

Pure Electric Three-Wheel Leaf Collection Vehicle, Leaf Transfer Special Vehicle

To solve this problem, a pure electric three-wheeled leaf collection vehicle emerges at the historic moment, it can easily solve the problem of leaf collection and transport in scenic spots, garden properties and other narrow areas.

Four-Wheel Fog Gun Sprinkler Has Multiple Functions and Full Performance

This Four-Wheel Fog Gun Sprinkler is very suitable for residential areas, factories, streets and other outdoor dust suppression and disinfection use. However, there are many large areas for dust suppression and disinfection in residential areas, factories

The Electric Three-Wheeled Sweeper Is Very Flexible When Driving

When we choose an Electric Three-Wheeled Sweeper, we will compare many models. What characteristics will we care about? The first is the applicability of the sweeping car, in the end this sweeping car can sweep? Second is the price, price is very importan

Electric Street Sweepers Require Frequent Maintenance

During the use of the Electric Street Sweepers, we need to regularly check cleaning and maintenance of the sweeping car, so as to extend the service life of the sweeping car, the use of will be more satisfactory.

In What Fields Is the Electric Street Washer Mainly Used?

Electric Street Washer is often used in the city cleaning, the use of Electric Street Washer is more and more, after it washed once again the road clean, dust problems can be solved, there is a large garbage, and then piled together, after the electric

Baiyi with the New Street Sweeper on the Scene of the Canton Fair

At present, the 133rd Canton Fair has come to a successful conclusion. This event, known as "the first exhibition of China's foreign trade", has attracted enterprises from all over the world. The scale of this exhibition is not only the largest

Four-Wheel Street Washer Vehicle to Help Sanitation Environment Construction

Four-wheel Street Washer vehicle has brought great convenience and benefits for the construction of urban environmental sanitation. This multi-functional cleaning vehicle is small but powerful. It can carry out a variety of cleaning modes, such as side fl

Small Pure Electric Street Sweeper Street Photography

In the streets of many cities, we can see more and more Small Pure Electric Street Sweeper​ . With its high efficiency and environmental protection characteristics, these pure electric cleaning vehicles are making great contributions to the better living

Electric Hanging Bucket Garbage Sanitation Car Battery Maintenance

ElectrichangingbucketgarbagesanitationvehiclebatterymaintenanceinstructionsSanitationvehiclesarecloselyrelatedtoresidents'lives.Smallelectricgarbagesanitationvehiclesmeetthe

Street Washer Vehicles help sanitation and environmental construction

the appearance of Street Washer Vehicles has brought great convenience and benefits for the construction of urban environmental sanitation. This multi-functional cleaning vehicle is small but powerful. It can carry out a variety of cleaning modes, such as

Road Street Washer Tricycle function detailed display

In order to cope with different needs of various sections and environments, this Road Street Washer Tricycle is equipped with different functions to cope with.

Lawn leaf suction machine can be used for lawn to absorb dead leaves

Atpresent,withthecontinuousimprovementofurbangreeningrate,thenumberoffallenleavesinautumnalsoincreases,especiallyinareaswhereleavesareconcentrated,theleavesthatneedtobe

China International Sanitation and Cleaning Equipment Exhibition

Recently, the China International Sanitation and Municipal Facilities and Cleaning Equipment Exhibition was successfully concluded in Beijing. The exhibition is a major industry event, attracting professionals and companies from all over the world to part

Rural small street sweeper introduction

Small cleaning equipment can choose the electric small street sweeper with dust removal and cleaning functions on the ground. First of all, this pure electric mode belongs to the concept of new energy and green environmental protection, and can be cleaned

Application field of electric road sweeper

We always mention that the electric road sweeper can be applied here, can be applied there, today entered a certain business center, yesterday a factory purchased an electric road sweeper and so on, that about the application of the electric road sweeper,

Pure electric garbage collector to solve the current property community garbage

Withtheaccelerationofurbanizationandtheincreasingnumberofresidents,theproblemofgarbageremovalisbecomingmoreandmoreprominent.However,thetraditionalwayofgarbageremovaloften

All-electric road sweepr clean urban roads

With the continuous progress of science and technology, pure electric road sweepr has become a new type of efficient and environmental protection cleaning equipment, which is particularly outstanding in the cleaning work of sidewalks. The pure electric cl

Three-Wheeled Street Washer Tricycle To Solve The Narrow Road Cleaning Work

However, now there is a new type of cleaning equipment - Three-Wheeled Street Washer Tricycle, can easily solve these problems. The Three-Wheeled Street Washer Tricycle​ is very passable, it is designed so that it can pass through narrow roads and curved

​ Introduction to Our Company's ElectriC Street Washing Vehicle

Our company has designed and produced an ElectriC Street Washing Vehicle specifically for the needs of small-area environmental sanitation cleaning, property management, and cleaning companies. This easy-to-use mobile washing vehicle is equipped with a

Small Electric Garbage Trucks: Efficient and Eco-Friendly.

Small Electric Garbage Trucks are fast electric environmentally friendly vehicles suitable for use in communities and other areas. They reduce the labor intensity of sanitation workers, improve work efficiency, and enhance the image of urban environment

The Cost-saving Benefits of Small Electric Sweepers in Factory Cleaning

Some large factories have started using enclosed Small Electric Sweepers to clean the factory, which enables the factory to pass strict environmental inspections. The factory floor needs cleaning, and the factory needs to be cleaned promptly. Such large

Small Multi-Function Street Dust Suppression Spraying Truck Sprinkler

The wind-sent remote fog cannon used in the Small Multi-Function Street Dust Suppression Spraying Truck Sprinkler has a horizontal range of up to 30 meters. Coupled with efficient atomizing nozzles, the dust suppression efficiency can reach up to 98%.

Electric Road Sweeper: An Efficient and Versatile Cleaning Solution

Electric Road Sweeper are characterized by their efficiency, versatility, and labor-saving features, making them ideal for use in outdoor areas and public spaces such as parking lots, workshops, residential complexes, schools, hospitals, and parks. They

Electric Road Washer Vehicle for Property, School, Factory, and Road Cleaning

The Electric Road Washer Vehicle, also known as a road cleaning vehicle​ or guardrail cleaning vehicle, uses high-pressure water flow to clean the ground, garbage bins, guardrails, and other areas. It is powered by a gasoline high-pressure pump and can al

CE

Small Electric Street Washer Vehicle: A Multi-Functional Sanitation Equipment

The Small Electric Street Washer Vehicle, also known as the small road washer , is a sanitation equipment that uses high-pressure water flow for quick cleaning and maintenance. This vehicle has powerful functions and multiple operating modes, which can be

Introducing the Efficient and Eco-Friendly Small Electric Garbage Truck

The small electric garbage truck adopts an 80AH 72V Tieneng heavy-duty electric vehicle special battery and a 3000W DC (AC) motor with strong power and long range, and stronger climbing ability. The hydraulic operation has a self-unloading function and ca

How to Handle Battery Leakage on an Electric Sanitation Vehicle

As electric sanitation vehicles become more sophisticated, they are bound to encounter common problems and challenges in their routine use. For maintenance personnel who operate and maintain these vehicles, it is essential to understand how to handle mech

New Energy Anti-aircraft Gun Mobile Greening Sprinkler Vehicle

New Energy Anti-aircraft Gun Mobile Greening Sprinkler Vehicle, also known as new Small Water Bowser Tricycle is mainly used for road sprinkler, factory spraying, dust suppression, small fire rescue, landscaping, drugging and so on.

How Is the Effect of Electric Ride on Sweeper Used in Cement Floor Workshop?

The Electric Ride on Sweeper is a kind of fast and efficient ground cleaning equipment. Many customers call and ask, how about the sweeper in the cement floor workshop? Xiaoban optimization says that the Electric Ride on Sweeper ​is developed for the clea

Three-wheeled high-pressure washing vehicle escorts property cleaning

Three-wheeled High-pressure Washing Vehicle, in addition to the sanitation market, in the commercial sector, the sales of Three-wheeled High-pressure Washing Vehicle increased.

The Rise of Intelligent Electric Street Sweepers for Industrial Use

Nowadays, electric street sweepers are becoming increasingly popular among factories and enterprises. They can be seen in various places such as factories, roads, streets, stations, schools, parks, and residential communities. These small machines contr

Small Garbage Trucks Clean up the Trash in the City

Small Garbage Trucks can be called sanitation vehicle and waste transport vehicle, the purpose of transportation sanitation garbage truck is environmental protection, reduce soil pollution, reduce the spread of pathogenic bacteria, the earth's atmosphere

Electric Street Washer without pressure is how to solve

In the process of using the Electric Street Washer, the user will inevitably encounter some minor problems after a long time of use. So when we find that the pressure is not up, how do we do the elimination check?

Electric Four-wheel Sorting Garbage Truck

The electric four-wheel garbage sorting truck is used for the transportation and transfer of environmental sanitation sorting garbage. The electric four-wheel sorting garbage truck​ uses battery as the power, economic, environmental protection, beautiful

What Are the Benefits of Using Electric Ride on Sweeper Properties?

The Electric Ride on Sweeper is an important "helper" used by the property company to improve the environmental quality of the community. To continuously improve the quality of living environment, enhance the happiness of urban residents, sen

Electric Driving Sweeper Performance Advantages

Industrial and commercial cleaning environments will definitely use Electric Driving Sweeper rather than artificial brooms, mainly because the performance advantages of electric sweepers are strong enough.

The Advantages of Electric Street Floor Sweepers

Electric Street Floor Sweepers is generally more than three wheels, especially for factories, supermarkets and property sites. These places for the sweeping car requirements are not high sanitation departments, only need the sweeping car flexible and smal

Precautions for Using Three-wheeled Electric Garbage Trucks

Three-wheeled Electric Garbage Trucks has the characteristics of energy saving, environmental protection, low cost, high flexibility, convenient sanitation workers at any time to collect garbage and debris, is a good helper of cleaning work.

What Are the Functions of Electric Street Washer Vehicles

The electric street washer bursts open the blocked pipe through the strong pressure generated by the high-pressure water flow. The main components are tank body, high pressure pump, hydraulic system, etc. The principle of the electric high-pressure cleani

Can electric sanitation sweeper use lithium battery?

Dynamic electric sanitation sweeper is now used in various fields, such as municipal sanitation, property, tourist attractions, station machine Yang, industrial park, logistics and warehousing, electric sanitation sweeper​ installed battery there are two

Small Urban Sanitation High Pressure Washing Vehicle

The small high-pressure cleaning vehicle for sanitation uses the frame of well-known domestic brand manufacturers, which is strong, durable, anti-corrosion, heavy load and so on. The most important feature is that the quality is guaranteed.

How to Deal with Electric Garbage Truck Dampness and Water?

The appearance of small electric garbage truck to the majority of sanitation workers has brought great convenience, improve the efficiency of sanitation work at the same time, but also improve the working conditions of sanitation workers, the appearance o

Electric Sanitation Sweeper Improves Cleaning Efficiency

The one-button control system of the electric sanitation sweeper makes the operation more simple, the environmental work will be humanized design, so that the sanitation workers ride more comfortable, four side brush rolling cleaning with high power fan

Brief Description of New Small Electric Sprinkler Truck

The small electric sprinkler truck makes this piece in the tank, the shape is circular, and the front of the tank makes a sitometer tube, which can check the water level inside the tank at any time; An inlet tank is installed at the top, with safety hand

New Type Small Electric Garbage Truck

The new small electric garbage truck, also known as mini garbage pickup truck, is suitable for the use of residential areas, it not only reduces the labor intensity of sanitation workers, but also improves the work efficiency, and improves the good image

Advantages of Electric Sanitation Garbage Trucks

The electric sanitation garbage truck, with its small size and flexible turning ability, is suitable for cleaning non-motorized lanes and back streets. It is a washing and sweeping vehicle, designed to avoid causing dust pollution. Its battery-powered

Baiyi Exhibits at Shanghai International Clean Technology and Equipment Expo

March 28-31, 2023, the CCE Shanghai International Clean Technology and Equipment Expo will be held at the Shanghai New International Expo Center (No. 2345 Longyang Road, Pudong), and the electric environmental sanitation road flushing vehicle pioneer,

Advantages of Using Electric Road Sweepers for Efficient Cleaning

Using electric road sweepers saves more time and manpower than manual cleaning. Electric sweepers work meticulously, collecting dust, sand, stones, leaves, fruit peels, paper scraps, and other garbage mercilessly into the dustbin. Electric sweepers have

Baiyi Participated In The 2023 East China Annual Sanitation Conference

March 29, 2023 the 29th East China Environmental Sanitation Annual Meeting will be opened in Nanjing on 29 grand opening. Many leaders and representatives of environmental sanitation departments, associations and related organizations in Jiangsu Province,

Electric High-Pressure Cleaning Vehicle : Efficient and Easy Operation

An Electric Three-Wheeled High-Pressure Cleaning Vehicle with a small volume and strong passability. It is powered by a pure electric driving force and has two battery options: lithium iron phosphate and ternary lithium batteries. Equipped with a lift

Efficient Leaf and Garbage Collection with Tree Leaf Vacuum Machine

which is where this leaf vacuum machine comes in handy. As long as the towing vehicle has a large enough bucket, it can collect for a long time. The leaf vacuum machine​ is equipped with a 5.5Hp Zongshen gasoline engine and a 6-8. It can collect for a lo

Small Water Spray Truck Used As Site Dust Landscaping Watering Spray

Small Water Spray Truck for pure electric, economic and environmental protection, optional fuel fog cannon, handheld water cannon. The battery is used as a tenance-free battery or super - power battery. Water pump: DC brushless self-priming pump, pump pow

Several Highlights of Electric Sanitation Street Washer and Sweeper

Several Highlights of Electric Sanitation Street Washer and Sweeper 1. The vehicle comes with the function of working mode, which can be started with one button, and the vehicle can enter the working speed, thus making the road environment safer and mo

Small Road Wash Vehicle Used by Community Property

Small Road Wash Vehicle ​Used by Community Property Property community, school campus, want high pressure to clean the road, garbage cans, guardrail, wall. I want to water lawns and green belts, and I don't want to get complaints from residents and stu

Efficient and Eco-Friendly Campus Cleaning with Small Electric Sprinkler Truck

For campuses with large areas and a lot of greenery, this small electric sprinkler truck is equipped with a first-line brand maintenance-free battery with a range of up to 80 kilometers and a longer service life. Additionally, the entire vehicle is powe

Maintaining Electric Floor Sweepers: When to Replace the Soft Brush

The pure electric sweeping machine is a popular cleaning tool in the cleaning industry. With the continuous improvement of various technologies, the pure electric sweeping machine is also constantly improving and getting better. The emergence of electri

Can pure electric sweepers be used in places like parking lots?

Pure electric sweepers are not prone to dust when cleaning. Parking lots are mainly composed of epoxy and resin floors, which are dustproof, waterproof, oil-proof, fireproof, and easy to clean. Especially when cleaning with pure electric sweepers​,

Introducing the Compact Electric Garbage Truck

Nowadays, advocating for low-carbon and environmental protection, Baiyi has produced this small electric four-wheel garbage truck. Despite its small size, the vehicle is extremely flexible and compact, occupying less space on the road and suitable for

Maintenance Tips for Pure Electric Sanitation Vehicles

Using pure electric sanitation vehicles in our daily lives is not only convenient for keeping our environment clean, but it also avoids secondary pollution. Nowadays, not only the government but also many residential communities and enterprises are usin

The Benefits of Road Sweeper Trucks for Environmental Sanitation Workers

Road Sweeper Trucks have become a new favorite in the sanitation industry. So what are the advantages of road cleaning vehicles, and what is their significance for sanitation workers? Traditional road cleaning methods are time-consuming, labor-intensive

Efficient and Versatile Electric Tricycle Water Sprayer

The electric three-wheeled mist cannon vehicle has 5 functions including mist cannon, high cannon, side spray, bottom spray, and washing function. It can be equipped with 48V and 60V batteries and has the characteristics of uniform spraying and long

The Benefits of Electric Garbage Trucks for Urban Communities

Electric garbage trucks are suitable for use in residential areas, as they not only reduce the workload of sanitation workers but also enhance work efficiency, creating a positive image for urban sanitation. They are ideal for use in various communities

Advantages of Electric Sweepers in Large-Scale Cleaning

provide superior cleaning results that cannot be achieved manually, making them a popular choice for cleaning large areas such as municipal roads, public squares, schools, and factories. These machines are widely used in today's society due to their

Repairing a Damaged Water Pump in an Electric Three-Wheeled Sprinkler Truck

Electric three-wheeled sprinkler trucks are used regularly on the streets day after day, year after year. Sometimes, due to overloading, some components of the vehicle may be damaged, such as the water pump. What should we do if the water pump of an

Small Road Sweeper - The Best Solution for Cleaning Roads

Small road sweepers are widely used in squares, highways, urban and rural roads, streets, residential areas, parking lots, docks, airports, railway stations, cement plants, power plants, underground parking lots, parks, scenic spots, factories, mining

Revolutionizing Cleaning: The Rise of Electric Street Sweepers

ElectricStreetSweepers,asanewfavoriteinthefieldofenvironmentalprotection, havemanycleaningadvantages.Forexample,theyhavehighcleaningefficiency, cansavealotofmanp

The New Way of Road Washing and Sweeping Vehicle

The road washing and sweeping vehicle has revolutionized the traditional cleaning process by adopting a wash-sweep approach instead of dry sweeping. The vehicle uses a combination of sweeping brushes and a centralized cleaning and suction system to perf

Discover the Versatile Four-Wheel Road Cleaning Truck for Efficient Cleaning

The four-wheel high-pressure cleaning vehicle is a vehicle with a stainless steel body and customizable paint job. It features a large-capacity 1000L integrated plastic water tank and a cold-rolled U-shaped steel frame assembled using cold riveting

​Electric Three-Wheeled Road Washer for Urban Cleaning

The electric three-wheeled road washer is powered by new energy batteries, making it more environmentally friendly. It is designed for cleaning sidewalks, side roads, curbs, small streets, and public facilities such as trash cans and fruit boxes. The ve

Multifunctional Electric Tree Leaf Collection Tricycle

urban green space management. Traditional cleaning methods often require manpower and time, are inefficient, and can also cause environmental pollution. To solve this problem, a multifunctional electric tree leaf collection tricycle has emerged.

Electric High-Pressure Cleaning Vehicle with Three Wheels

The Electric Three-Wheeled High-Pressure Cleaning Vehicle is a mobile and user-friendly washing vehicle designed specifically for environmental sanitation, property management, and cleaning companies, incorporating advanced cleaning concepts. The product

Side-Hanging Bin Truck: A Solution to Environmental Sanitation in Old Communitie

Our company has introduced a side-hanging bin truck to solve the problem of narrow road construction in old neighborhoods which cannot accommodate large garbage trucks. This move not only provides efficient environmental sanitation tools, but also contrib

Electric three-wheeled garbage truck Baiyi-L10 shipped

Recently, a small electric garbage tricycle customized by the sanitation company, also known as the "sorting garbage tricycle", has completed assembly, debugging, loading, and ready to be sent to the delivery place designated by the guests, the

Small Electric Road Sweeper Baiyi-S50 Ready to Ship

Automatic Small Electric Road Sweeper Baiyi-S50 , with various functions such as road cleaning, super-strong road cleaning, curbstone and curbstone facade scrubbing, garbage and sewage recycling, spray dust reduction, low-pressure washing, etc.

A Three-wheeled Leaf Collector on the Street in Tai 'an

The three-wheeled leaf collector vehicle is a hybrid leaf collector, which uses battery power for walking and gasoline engine for working. High endurance, large suction, can freely shuttle in the roadway, back streets, alleys, narrow streets for leaf,

New Energy Electric Three-wheel Water Sprinkler Vehicle

New Energy Electric Three-wheel Water Sprinkler Vehicle is a new low carbon environmental protection off-highway driving electric sprinkler, it has excellent performance, and driving comfort. Vehicle size, load, according to the user's actual use requirem

Small High-pressure Street Washer Flushes the Sidewalk Bike Path

The small street washing equipment represented by Small High-pressure Street Washer​ is a new environmental sanitation operation tool developed in line with the refined and mechanized trend of contemporary environmental sanitation. With a traditional

How to Identify the Good or Bad Tire of Small Sanitation Garbage Truck?

The good and bad tires of small garbage truck are very important to the vehicle. The following small sanitation garbage truck​ for everyone to share a few simple easy to learn to identify the good method of tires.

Exploring the Categories and Features of Small Electric Garbage Trucks

small electric garbage trucks on the market, so what are the main categories of them? According to the way of garbage collection: there are two main ways of garbage collection, one is the rear tipping bucket garbage truck (also called the rear tipping

Electric Street Sweeper Function Introduction

Electric Street Sweeper is a collection of cleaning, vacuuming, spray in one of the multifunctional Electric Street Sweeper​. Compared with manual, cleaning efficiency is higher, the cleaning efficiency of an Electric Street Sweeper is about 12 times

Electric High Pressure Road Washing Vehicle Maintenance

To clean the vehicle, the structure of the Electric High Pressure Road Washing Vehicle is based on electric energy, so what should be paid attention to the cleaning of the Electric High Pressure Road Washing Vehicle​?

New Energy Electric Fog Cannon Water Sprinkler Tricycle

Along with our country vigorously advocated new energy environmental protection goal, many cities are beginning to configure Electric Fog Cannon Water Sprinkler Tricycle`, here are introduced the advantage of Electric Fog Cannon Water Sprinkler Tricycle

High Pressure Street Washer Machine Brief Introduction

High Pressure Street Washer Machine is also known as four-wheel multifunctional high pressure cleaning vehicle and small high pressure washing vehicle.​ The overall appearance of the vehicle is made of stainless steel body, sheet metal painting (can be cu

Electric Three-wheeled Sanitation Sweeper

A customer who plans to buy an Electric Three-wheeled Sanitation Sweeper asks if it can be cleaned. Today Xiaobian to have a good chat with you.

Small Street Washer Machine Are Compact and Designed for Sidewalks

Recently, a batch of Small Street Washer Machine transported to Shenzhen by Baiyi arrived smoothly. This model is a customized appearance color for Shenzhen Environmental Sanitation Company. After the arrival of the vehicles, the vehicle handover ceremony

Small Electric Garbage Truck Shopping Guide

Small Electric Garbage Truck has become an important tool of garbage pickup, is a helpful helper for cleaning workers to complete their work every day, so choose electric garbage pickup truck to choose good quality, durable, of course, is suitable for th

Precautions for Charging Small Electric Sanitation Vehicles

Ensuring the safe use of the battery can also extend its service life. Next Xiaobian to introduce the Small Electric Sanitation Vehicles​ charging precautions. Let's take a look.

Electric High Pressure Washing Truck Daily Work

The Electric High Pressure Washing Truck​ adopts the tricycle body as the carrier with small body size and good passability. The cleaning effect is good, usually by the property community, colleges and universities need high pressure cleaning units.

Configuration of Street Washing Vehicles

Street Washing Vehicles can be used for dredging and washing dead corner dirt, but also can clean industrial pipes, walls, cleaning the road square ground can also be installed with sprinkling function, greening sprinkling and Gao Le spray dew, fire and

Electric Street Sweeper is Easy to Operate and Low Maintenance Cost

Electric Street Sweeper is a new type of sweeper, using brushes and air flow operation, relying on the principle of aerodynamics, water spraying, no dust, no secondary dust, Electric Street Sweeper​ operation using air to complete, sweep combined, no seco

Electric Sanitation Garbage Truck Maintenance Method

Electric sanitation garbage truck is a new model specially designed to adapt to social development, with the effect of energy saving and emission reduction. Has been unanimously recognized by the society. So how should we use and maintain it in our daily

Notes for Battery Installation of Electric Street Washer

Electric Street Washer is a new type of cleaning car, has a great role in cleaning road stains, the main driving equipment of the vehicle is the battery, is the main momentum source of the vehicle operation, once the battery problems, the vehicle will not

City Streets Use Electric Sweeper Trucks

Urban streets represent the environmental image and appearance of a city, county and town, and community leaders attach great importance to them. If you want the streets to be clean and fresh, you must rely on the common maintenance and love of residents

Back street and alley wash street washer more flexible

Recently, the sidewalk street washer sent to a sanitation company in Inner Mongolia has arrived at the customer's designated delivery place, and the installation and debugging is completed. The products shipped this time are hot selling products, using

The street washer vehicle has been handed over to a sanitation company

Recently, the strret washer vehicle sent to a sanitation company in Inner Mongolia has arrived at the customer's designated delivery place, and the installation and debugging is completed. The products shipped this time are hot selling products, using

5.5hp Zongshen Gasoline Gasoline Leaf Suction Machine

Leaf suction machine adopts 5.5Hp Zongshen gasoline engine and is installed with 6-8 meters extentable hose. The machine can absorb leaves and garbage within 10 meters of the surrounding area once parked.

Road Maintenance Truck

Road Maintenance Truck, with multi-functional washing operation ability, mainly used for urban sidewalks, side roads, the quick washing and cleaning of the stone along the road, as well as urban small advertising cleaning, fruit boxes and garbage

Electric Three-wheel Street Washer Use Method

1. The Electric Three-wheel Street Washer Vehicle​ is also modified with high pressure printer nozzle on both sides of the vehicle body, which can carry out washing on the road surface while running, with higher washing efficiency. The range of reasonable

Small Electric Garbage Truck Tire Burst Prevention Method

Small Electric Garbage Truck is a good helper of cleaning workers. It has been widely used now. It not only improves the efficiency of garbage removal, but also reduces the labor intensity of the staff, and makes a contribution to our construction of a be

Street Washer Vehicle Maintenance and Maintenance Measures

Street Washer Vehicle​ Maintenance and Maintenance Measures The application should carry out timely maintenance of the high-pressure cleaning car in accordance with the prescribed maintenance cycle time and maintenance items, so as to make full use of the

Multi-function street washer vehicle at night loading to a sanitation company

four-wheel street washer vehicles have been loaded and shipped on time. This batch of multifunctional street washer vehicles with a new front, more novel appearance, electrophoretic paint is the vehicle colorful to improve the image of the city.

Small electric garbage truck noise is small for the community

resulting in more and more household garbage. Improper disposal of household garbage will undoubtedly cause great trouble to residents, so for the property, it is crucial to choose a suitable small electric garbage truck for the property community!

Small electric garbage trucks reduce urban garbage pollution

Electric garbage trucks generally use closed boxes, garbage removal process no residue, less exposure, compared with fuel vehicles, no unpleasant odor, will not cause secondary pollution;

Efficient Leaf Removal Made Easy with Commercial Leaf Removal Equipment

Commercialleafremovalequipmenthasrevolutionizedthewaythathomeownersandcommercialpropertymanagersapproach leafcleanup.Thesepowerfulmachinesarespecificallydesignedtoremovel

Changing Electric Road Sweeper for Eco-Friendly and Efficient Street Cleaning

Biyi has introduced a new electric road sweeper. The design of this innovative vehicle offers a range of benefits over traditional street sweepers, including reduced emissions, increased efficiency and quieter operation.

Small Trash Compactor Truck for Sale

For businesses and municipalities that need to handle garbage collection efficiently, a small trash compacting vehicle​ is a good investment. The vehicles are designed to compress waste for more efficient storage and transport. If you are looking for a

Hot Sale Factory Price Parking Lot Street Sweeper Truck

The Electric Sweeper Truck is a great solution that offers powerful performance with low environmental impact. This eco-friendly sweeper truck is perfect for cleaning up trash, leaves and other debris in parking lots, streets, drives and more.

Using New Mini Street Sweepers in Cities

Use a new mini street sweeper in the city to help keep roads and sidewalks clean. The mini street sweeper is designed to remove small debris such as leaves, twigs, paper and trash from city streets and sidewalks. It has a powerful suction system that lift

Best Self Propelled Leaf Vacuum

A self-propelled leaf vacuum​ is a convenient and effective way to quickly take care of dead leaves, twigs, and other debris in your lawn or garden. Whether you have a small backyard or a large garden area, a self propelled leaf vacuum can make the job

Smart Sanitation Electric Sweeping Vehicles Have Entered the 5g Era

Intelligentenvironmentalsanitationequipmentpureelectriccleaningvehiclesmakeenvironmentalgovernanceintothe5Gera.Withthedevelopmentofsociety,peoplehavehigherandhigherrequirement

Economical High Pressure Cleaning Tricycle Delivery

The emergence of the economical high-pressure cleaning vehicle has brought great convenience and help to the construction of urban sanitation. In this article, we will focus on the delivery of the economical high-pressure cleaning vehicle, and how it can

Small Electric Garbage Trucks Are Sent to Vietnam

The small electric rear-loading garbage trucks are on their way to Vietnam to contribute to a better living environment. Waste management is a key issue in urban areas, and a reliable and efficient waste disposal solution is essential to maintaining

Electric Garbage Truck

Newly Produced Electric Watering Cart with 2000L Water Tank Capacity

The production of the electric watering cart with a 2000L water tank is complete. This state-of-the-art vehicle is the perfect solution for watering plants, flowers, and trees in public parks, gardens, and other urban areas.

2.3-ton Electric Road Sweeper Factory Direct for Sale

As a factory that specializes in the manufacturing of electric road sweepers, we offer a 2.3-ton electric road sweeper that is available for sale directly from the factory.